DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and SPBC12D12.05c

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_595952.1 Gene:SPBC12D12.05c / 2539713 PomBaseID:SPBC12D12.05c Length:426 Species:Schizosaccharomyces pombe


Alignment Length:297 Identity:88/297 - (29%)
Similarity:151/297 - (50%) Gaps:24/297 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ISGAAAGALAKTVIAPLDRTKINFQIRNDV------PFSFRASLRYLQNTYANEGVLALWRGNSA 135
            |||..||.:::|..|||||.|:  .:.:|.      .:.|...|...:..:...|:.:.:.||..
pombe   132 ISGGIAGIVSRTCTAPLDRLKV--MLISDTGSKPSPKYPFATLLHTTKVLWNRNGIRSFFVGNGI 194

  Fly   136 TMARIVPYAAIQFTAHEQWRRILHVDKDGTN-TKGRRFLAGSLAGITSQSLTYPLDLARARMAVT 199
            .:.:::|.::|:|..:|..:|:|.:.....| :....:|||.:||..:|...||:|..:.|:..:
pombe   195 NVLKVMPESSIKFGTYEAMKRVLGISSSSENHSPLYSYLAGGMAGSVAQMFIYPVDTLKFRIQCS 259

  Fly   200 DRYTGYRTLRQVFT---KIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNK 261
            |...|......:.:   :::...|.|..:||....:||:.||:.|...|:|.|||.:..::.:..
pombe   260 DLSRGQHGKSIILSNAKELYKSVGIRGYYRGVLVGILGMFPYSATDLGTFEGLKRTWIGILASRD 324

  Fly   262 ---------PNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYR 317
                     ||.|| :||||.:|:.|.|..:||:::|.|:|| :..:|....|...::...|..:
pombe   325 NVDPQDVKLPNGLV-MAFGALSGSTGATIVFPLNVIRTRLQT-QGTSAHPATYDGFIDCFYKTTK 387

  Fly   318 EEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWL 354
            .||.: |.|||||.|.:|...:|.||:..|:..|.||
pombe   388 NEGFR-GLYKGLSPNLLKVAPSVAISYLVYENCKKWL 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 23/87 (26%)
Mito_carr 169..251 CDD:278578 24/84 (29%)
Mito_carr 279..356 CDD:278578 27/76 (36%)
SPBC12D12.05cNP_595952.1 Abhydrolase <50..115 CDD:304388
Mito_carr 123..218 CDD:278578 23/87 (26%)
PTZ00169 131..423 CDD:240302 86/295 (29%)
Mito_carr 227..320 CDD:278578 26/92 (28%)
Mito_carr 332..424 CDD:278578 37/95 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1887
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.900

Return to query results.
Submit another query.