DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and SLC25A43

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_660348.2 Gene:SLC25A43 / 203427 HGNCID:30557 Length:341 Species:Homo sapiens


Alignment Length:285 Identity:86/285 - (30%)
Similarity:141/285 - (49%) Gaps:18/285 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARI 140
            |:....||.|:.::.|||:...:..|: ..|....|.........:..||:.|||:||:....|:
Human    16 LLCAGLAGTLSLSLTAPLELATVLAQV-GVVRGHARGPWATGHRVWRAEGLRALWKGNAVACLRL 79

  Fly   141 VPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTD-RYTG 204
            .|.:|:|..|:.:: .:|..|..|..::....:||||||:.|..:|||.||.:.|:.:.: ....
Human    80 FPCSAVQLAAYRKF-VVLFTDDL
GHISQWSSIMAGSLAGMVSTIVTYPTDLIKTRLIMQNILEPS 143

  Fly   205 YRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNKPNTLVSLA 269
            ||.|...|:.|:.:||...|:||...||:|.:|::..|...|..|::.:      |.|....||.
Human   144 YRGLLHAFSTIYQQEGFLALYRGVSLTVVGALPFSAGSLLVYMNLEKIW------NGPRDQFSLP 202

  Fly   270 FGAA----AGAAGQTASYPLDIVRRRMQTMR---VNTAGGD-RYPTILETLVKIYREEGVKNGFY 326
            ...|    |.|..||.|:|.:.|:|:||...   .::.|.| .:...::...:|.:.:||. |.:
Human   203 QNFANVCLAAAVTQTLSFPFETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQIVKAQGVL-GLW 266

  Fly   327 KGLSMNWIKGPIAVGISFSTYDLIK 351
            .||:.|.:|.....||.|||::..|
Human   267 NGLTANLLKIVPYFGIMFSTFEFCK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 22/82 (27%)
Mito_carr 169..251 CDD:278578 30/82 (37%)
Mito_carr 279..356 CDD:278578 24/77 (31%)
SLC25A43NP_660348.2 Mito_carr 8..101 CDD:278578 24/86 (28%)
Solcar 1 11..101 24/86 (28%)
Mito_carr 102..185 CDD:278578 29/82 (35%)
Solcar 2 105..185 28/79 (35%)
Mito_carr 197..293 CDD:278578 29/96 (30%)
Solcar 3 200..298 29/93 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253450at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.