DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and Slc25a43

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001078966.1 Gene:Slc25a43 / 194744 MGIID:2684854 Length:341 Species:Mus musculus


Alignment Length:294 Identity:87/294 - (29%)
Similarity:142/294 - (48%) Gaps:36/294 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFR--ASLRYLQNTYANEGVLALWRGNSATMA 138
            |:....|||.:.::.|||:...:..|:......|..  |:.|   ..:.:||..|||:||.....
Mouse    16 LLCAGLAGAFSLSLTAPLELATVLAQVGKVQSHSLGLWATGR---RVWLSEGPRALWKGNGVACL 77

  Fly   139 RIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTD-RY 202
            |:.|.:.:|..|:.:: .:|.:|..|..::....:.|||||:.|..:|||.||.:.|:.|.: ..
Mouse    78 RLFPCSMVQLAAYRKF-VVLFMDDL
GRISQWSSIVTGSLAGMVSTIVTYPTDLIKTRLMVQNVLE 141

  Fly   203 TGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNKP----N 263
            ..||.|...|:.|:.:||...|:||...||||.:|::..|...|..|::.:      |.|    :
Mouse   142 PSYRGLIHAFSTIYQQEGFLALYRGVSLTVLGAVPFSAGSLLVYMNLEKVW------NGPRDRFS 200

  Fly   264 TLVSLAFGAAAGAAGQTASYPLDIVRRRMQT----------MRVNTAG-GDRYPTILETLVKIYR 317
            .|.:.|....|.|..||.|:|.|.|:|:||.          :.|:.:| .|.:..|::|      
Mouse   201 HLQNFANVCVAAAVSQTLSFPFDTVKRKMQAQSPYLPHYGGVDVHFSGAADCFRQIVKT------ 259

  Fly   318 EEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIK 351
             :||. |.:.||:.|.:|.....|:.||.::..|
Mouse   260 -QGVL-GLWNGLTANLLKVVPYFGVMFSMFEFCK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 22/84 (26%)
Mito_carr 169..251 CDD:278578 31/82 (38%)
Mito_carr 279..356 CDD:278578 25/84 (30%)
Slc25a43NP_001078966.1 Mito_carr 8..101 CDD:278578 24/88 (27%)
Solcar 1 11..101 24/88 (27%)
Mito_carr 102..185 CDD:278578 30/82 (37%)
Solcar 2 105..185 29/79 (37%)
Mito_carr 197..295 CDD:278578 29/103 (28%)
Solcar 3 200..298 29/100 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253450at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.