DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and SLC25A25

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001317917.1 Gene:SLC25A25 / 114789 HGNCID:20663 Length:515 Species:Homo sapiens


Alignment Length:290 Identity:107/290 - (36%)
Similarity:157/290 - (54%) Gaps:26/290 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LISGAAAGALAKTVIAPLDRTKINFQIR----NDVPF--SFRASLRYLQNTYANEGVLALWRGNS 134
            |::|..|||:::|..|||||.|:..|:.    |::..  .|...:|       ..|..:|||||.
Human   236 LVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMGIVGGFTQMIR-------EGGARSLWRGNG 293

  Fly   135 ATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVT 199
            ..:.:|.|.:||:|.|:||.:|::..|:: |.....|.:||||||..:||..||:::.:.|||: 
Human   294 INVLKIAPESAIKFMAYEQIKRLVGSDQE-TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMAL- 356

  Fly   200 DRYTG-YRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYE--VVGNNK 261
             |.|| |..:.....:|...||....::||...:||:|||||.....|||||..:.:  .|.:..
Human   357 -RKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQHYAVNSAD 420

  Fly   262 PNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTI-LETLVK-IYREEGVKNG 324
            |...|.||.|..:...||.|||||.:||.|||..    |..:..|.: :.:|.| |.|.||. .|
Human   421 PGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQ----ASIEGAPEVTMSSLFKHILRTEGA-FG 480

  Fly   325 FYKGLSMNWIKGPIAVGISFSTYDLIKAWL 354
            .|:||:.|::|...||.||:..|:.:|..|
Human   481 LYRGLAPNFMKVIPAVSISYVVYENLKITL 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 31/88 (35%)
Mito_carr 169..251 CDD:278578 34/82 (41%)
Mito_carr 279..356 CDD:278578 32/78 (41%)
SLC25A25NP_001317917.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1887
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.