DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and slc25a16

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001135682.1 Gene:slc25a16 / 100216243 XenbaseID:XB-GENE-1004686 Length:320 Species:Xenopus tropicalis


Alignment Length:305 Identity:117/305 - (38%)
Similarity:172/305 - (56%) Gaps:45/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYA---NEGVLALWRGNSAT 136
            |.::|..|...|||.||||||.||..|.:|   ..:| .|..|...:|   .||.|.|::||.|.
 Frog    27 SFVAGGVASCCAKTTIAPLDRIKILLQAQN---VHYR-HLGILATAFAVQKKEGFLGLYKGNGAM 87

  Fly   137 MARIVPYAAIQFTAHEQWRRIL--------HVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLAR 193
            |.||.||.||||.|.:::::::        ||.         |.:|||:||||:...|||||:.|
 Frog    88 MVRIFPYGAIQFMAFDKYKKMIKKKIKHSEHVP---------RLMAGSMAGITAVIFTYPLDMVR 143

  Fly   194 ARMAV----TDRYTGYRTLRQVFTKIWVEEGP-RTLFRGYWATVLGVIPYAGTSFFTYETLK--- 250
            ||:|.    ..||.|   :...|..|:::||. |..:||...|::|:.||||.||||:||||   
 Frog   144 ARLAFQVKGEHRYNG---IIHAFKTIYLKEGGIRGYYRGLVPTIVGMAPYAGFSFFTFETLKTAG 205

  Fly   251 -REYYEVVG---NNKPNTLV-----SLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYP 306
             |...|::|   ::.|:.:|     ||..|..|||..|:.|||||:.|||||...: ....|:..
 Frog   206 LRHAPELLGKPSSDNPDVMVLKTHASLLCGGIAGAIAQSISYPLDVTRRRMQLSAI-LPDSDKCR 269

  Fly   307 TILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIK 351
            |:.:||..:..:.|::.|.|:|||:|:|:...:..::|:||:.::
 Frog   270 TMFQTLKYVCMQHGIRRGLYRGLSLNYIRCIPSQAVAFTTYEFMR 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 37/94 (39%)
Mito_carr 169..251 CDD:278578 41/90 (46%)
Mito_carr 279..356 CDD:278578 26/73 (36%)
slc25a16NP_001135682.1 PTZ00169 24..298 CDD:240302 113/287 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D484613at33208
OrthoFinder 1 1.000 - - FOG0001300
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X798
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.