DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and slc25a23

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001135638.1 Gene:slc25a23 / 100216197 XenbaseID:XB-GENE-5998763 Length:467 Species:Xenopus tropicalis


Alignment Length:288 Identity:103/288 - (35%)
Similarity:158/288 - (54%) Gaps:23/288 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARI 140
            |::|..|||:::|..|||||.|:..|:......|.   ||.|:......||.:|||||...:.:|
 Frog   189 LLAGGVAGAVSRTGTAPLDRLKVLMQVHGSQGLSI---LRGLRVMIEEGGVRSLWRGNGINVIKI 250

  Fly   141 VPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAV--TDRYT 203
            .|.:||:|.|:||.::::....:....: .||:||||||..:|:..||:::.:.|||:  |.:|:
 Frog   251 APESAIKFMAYEQIKKLIRGQHETLRVR-ERFIAGSLAGAIAQTAIYPMEVLKTRMALRRTGQYS 314

  Fly   204 GYR-TLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREY---YEVVGNNKPNT 264
            |.. ..||:..    .||.|..|:||...:||::||||.....|||||..:   |....:..|..
 Frog   315 GMSDCARQILR----NEGVRAFFKGYIPNLLGIVPYAGIDLAVYETLKNTWLQRYRSSTSADPGV 375

  Fly   265 LVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGF---Y 326
            ||.||.|..:...||.|||||.:||.|||. :.:..|..:.     ::|.::|....:.||   |
 Frog   376 LVLLACGTVSSTCGQIASYPLALVRTRMQA-QASVQGSPQL-----SMVALFRHIVAREGFLGLY 434

  Fly   327 KGLSMNWIKGPIAVGISFSTYDLIKAWL 354
            :|::.|::|...||.||:..|:.:|..|
 Frog   435 RGIAPNFMKVIPAVSISYVVYENMKRLL 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 32/82 (39%)
Mito_carr 169..251 CDD:278578 35/84 (42%)
Mito_carr 279..356 CDD:278578 27/79 (34%)
slc25a23NP_001135638.1 EF-hand_7 18..75 CDD:290234
EFh 19..73 CDD:238008
EFh 59..104 CDD:238008
EFh 85..142 CDD:238008
EF-hand_7 85..137 CDD:290234
Mito_carr 185..270 CDD:278578 32/83 (39%)
PTZ00169 190..462 CDD:240302 101/285 (35%)
Mito_carr 279..366 CDD:278578 36/90 (40%)
Mito_carr 372..463 CDD:278578 34/97 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1887
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.