DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS9 and THI73

DIOPT Version :9

Sequence 1:NP_650889.1 Gene:MFS9 / 42426 FlyBaseID:FBgn0038799 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_013104.1 Gene:THI73 / 850690 SGDID:S000003994 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:436 Identity:93/436 - (21%)
Similarity:161/436 - (36%) Gaps:84/436 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 GLILSSFFYGYILTQFLGGYIGTKIGGNIVFGTGIGSTAILTLLTPMAASHSLEMFLFVRIIEGF 157
            |.|.|:   .||..:.:..|:..|...:.:.||.|....|  :|...||..:....:.||.:.|.
Yeast   121 GTIFSA---AYIFMEPVVTYLIQKFPISKILGTFITVWGI--VLACHAACKTYASLMVVRTLLGL 180

  Fly   158 FEGVTFPGIHAVWARWSPPLERSRMASIAFAGNYAGT---VVAMPCSGFL---ATKY-GWESVFY 215
            ||..:..|..|:...:....|:|  |.|.|....|||   |..:...|||   .|.: .|:.:|.
Yeast   181 FESSSAVGCIAISGMYYTKSEQS--ARIGFWATQAGTGYIVGGLISFGFLHYHGTAFTSWQIMFL 243

  Fly   216 VFGTIGVIWYITWLVFVKAGPELDRFCSKEECDYIQKTI-----GYVGSKHVKHPWRAIFTSMPF 275
            |.|.:.|.:.:...:::........|.:|||...:.:.|     |....|..|...:.:|.    
Yeast   244 VVGLVTVAFGVLTFLYLPDNVTNAWFLNKEEKIQVVEHIRANQTGLETKKFKKQQVKELFL---- 304

  Fly   276 YAIMASHFSENWG--FYTLLTQLPS--------FLRDTLNFDLGKTGILSAVPYLAMG-----IL 325
                  |....|.  ..|..:|:.:        .:..|..||..:|.:|.    |.:|     |:
Yeast   305 ------HDKFTWPMLLLTACSQISTGAIGTFSVTITGTFGFDKYETALLQ----LPIGAITAMII 359

  Fly   326 LAVSGYLADWLQVKGIWTTTQVRRNFNCGAF----LAQTVFMMLTAYLLDPTWSVVSLTIAVGLG 386
            |..:..|:.|..:..|.|:..:.....|...    |:..:..:.:.|||.....|::       .
Yeast   360 LITTQMLSRWGHITLITTSMYIPAIIGCIVLISLPLSHKIGNLFSLYLLYSGSCVIT-------N 417

  Fly   387 AFAWSGFAVNHLDIAPQHASVLMGIGNTFATIPGIVSP-LLTGYVVTNQTSDEWRIIFFISAGIY 450
            .:.|:....:.........::.|.:.|    :..|::| :...|....          :|.|.|.
Yeast   418 IYIWNSCNTSGYTKRVFRNAITMIVYN----VSCIIAPQMFRAYSAPR----------YIPAKIA 468

  Fly   451 LV--GCV-----IYWFY-CSGDLQEWAKTPEQKAQEAEEKAQLQLT 488
            |:  .||     :|..| |..:.::  :..||:.||.::...|.||
Yeast   469 LLVTQCVCVPLQLYIGYICKKENEK--RDKEQEGQERKKYQFLDLT 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS9NP_650889.1 2A0114euk 38..477 CDD:129972 88/423 (21%)
MFS 42..460 CDD:119392 84/405 (21%)
THI73NP_013104.1 MFS_FEN2_like 77..481 CDD:340885 83/401 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I1824
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.