DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS9 and Slc17a9

DIOPT Version :9

Sequence 1:NP_650889.1 Gene:MFS9 / 42426 FlyBaseID:FBgn0038799 Length:502 Species:Drosophila melanogaster
Sequence 2:XP_038961483.1 Gene:Slc17a9 / 362287 RGDID:1311940 Length:448 Species:Rattus norvegicus


Alignment Length:338 Identity:102/338 - (30%)
Similarity:161/338 - (47%) Gaps:52/338 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SEPLTWRFWRKQRYIVVLLAFFGFFNVYSLRVNLSVAIVAMTENRTVFDADGNVSYQQDFPWDSK 90
            :|...|.....|.:..:||  .|...:|..||.:.|..|||:               |||.|:.|
  Rat    24 AEDKRWSRPECQLWTGMLL--LGTCLLYCTRVTMPVCTVAMS---------------QDFGWNKK 71

  Fly    91 QKGLILSSFFYGYILTQFLGGYIGTKIGGNIVFGTGIGSTAILTLLTPMAA---SHSLEMFLFVR 152
            :.|::|||||:||.|||.:||::|.:|||..|......:...:|:.||:.|   |..|....|.|
  Rat    72 EAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGFITVTTPLLAHLGSGHLAFVTFSR 136

  Fly   153 IIEGFFEGVTFPGIHAVWARWSPPLERSRMASIAFAGNYAGTVVAMPCSGFLATKYGWESVFYVF 217
            |:.|..:||.||.:.::.::.....|||...|...||:..||:|.......|..:.||:||||..
  Rat   137 ILTGLLQGVYFPALTSLLSQRVQESERSFTYSTVGAGSQVGTLVTGGIGSVLLDRCGWQSVFYFS 201

  Fly   218 GTIGVIW-YITWLVFVKAGPELDRFCSKEECDYIQKTIGYVG-----SKHVKHPWRAIFTSMPFY 276
            |.:.::| |..:...:            :|.|.: ..:|.:.     ::..|.|||.:|.....:
  Rat   202 GGLTLLWVYYVYKYLL------------DEKDLV-LALGVLAQGLPVTRPSKVPWRQLFRKASVW 253

  Fly   277 AIMASHFSENWGFYTLLTQLPSFLRDTLNFDLGKTGILSAVPYLAMGILLAV-----SGYLADWL 336
            |::.|..|....|:.||:.||:|.::|  |...|..:.:.||:     |||:     ||:::|.|
  Rat   254 AVICSQLSSACSFFILLSWLPTFFKET--FPHSKGWVFNVVPW-----LLAIPASLFSGFISDRL 311

  Fly   337 QVKGIWTTTQVRR 349
            ..:|....| ||:
  Rat   312 ISQGYRVIT-VRK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS9NP_650889.1 2A0114euk 38..477 CDD:129972 99/326 (30%)
MFS 42..460 CDD:119392 99/322 (31%)
Slc17a9XP_038961483.1 MFS 38..>326 CDD:421695 99/324 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.