DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS9 and SPCC757.13

DIOPT Version :9

Sequence 1:NP_650889.1 Gene:MFS9 / 42426 FlyBaseID:FBgn0038799 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_587688.1 Gene:SPCC757.13 / 2539039 PomBaseID:SPCC757.13 Length:522 Species:Schizosaccharomyces pombe


Alignment Length:393 Identity:86/393 - (21%)
Similarity:147/393 - (37%) Gaps:91/393 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 FFYGYILTQFLGGYIGTKIG-GNIVFGTGIGSTAILTLLTPMAASHSLEMFLFVRIIEGFFEGVT 162
            |:.||::.|:....:..|.. ...:|......:|::.|   |||..:....|.:|.:.|.||...
pombe   121 FYAGYLVAQYPAAILMQKCRLSYFIFCNVFLWSAMVCL---MAACRNGPSLLGLRFLAGIFEASI 182

  Fly   163 FPGIHAVWARWSPPLERSRMASIAFAGNYAGTVVAMPCSGFLATKYG----WESVFYVFGTIGVI 223
            .|....:.|.|....|:.......:|.|....::....|..|...:|    |..||.|.|.:.:.
pombe   183 TPAFINITAMWYRREEQPMRTLCWYAFNGIAQIIGSILSYGLGHIHGKVASWRYVFIVIGLMSLG 247

  Fly   224 WYITWLVFVKAGPELDRFCSKEECDYIQKTIGY-------VGSKHVKHPWRAIFTS-MPFYAIMA 280
            |.:.: ||:.:.|...||.|..|     |.|..       .|.::.:..|:..:.: :....||.
pombe   248 WGVVF-VFIPSNPSKARFLSSRE-----KRIALERVRDNRTGLENKQFKWKHAYEAFLDPQVIMI 306

  Fly   281 SHF------SENWGFYTLL-------TQLPSFLRDTLNFDLGK--------TGILSAV---PYLA 321
            :.|      :...|.::.|       .:|.|.:   ||..||.        :|:|..|   ..|.
pombe   307 TLFTGVCMITNGIGVFSTLIIKGLGYNELHSAV---LNMPLGAIEVAAMFISGVLCKVFKNGRLL 368

  Fly   322 MGIL---LAVSGYLADWL--------QVKGIWTTTQVRRNFNCGAFLAQTVFMMLTAYLLDPTWS 375
            :|:.   |.::|.|..|.        ::.|:|.|..|..:   .|.|...:...:..|...   :
pombe   369 IGVFMNCLTLAGCLMIWKIPDSNPYGRLVGVWFTMWVPAS---SALLLSLISSNVAGYTKK---T 427

  Fly   376 VVSLTIAVGLGAFAWSGFAVNHLDIAPQHASVLMGIGNTFATIPGI------------VSPLLTG 428
            |.|.|:.|        .::|.:: ::||    |...|.|...|.||            ::.:|||
pombe   428 VTSATVFV--------FYSVGNI-VSPQ----LFKSGQTPEYIEGIQAMIVSLCIIIAIAFVLTG 479

  Fly   429 YVV 431
            |.:
pombe   480 YYI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS9NP_650889.1 2A0114euk 38..477 CDD:129972 86/393 (22%)
MFS 42..460 CDD:119392 86/393 (22%)
SPCC757.13NP_587688.1 MFS 80..477 CDD:119392 82/386 (21%)
2A0114 83..478 CDD:273326 82/387 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.