DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS9 and SLC37A2

DIOPT Version :10

Sequence 1:NP_650889.1 Gene:MFS9 / 42426 FlyBaseID:FBgn0038799 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_938018.1 Gene:SLC37A2 / 219855 HGNCID:20644 Length:505 Species:Homo sapiens


Alignment Length:31 Identity:13/31 - (41%)
Similarity:14/31 - (45%) Gaps:1/31 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LKKNKLGKYNAEEMAKQEEERKRQEEEDRQK 151
            |.||| |.|...|.|:.|.....|.|.|..|
Human    46 LYKNK-GSYVTYEPAEGEPSAILQMETDSAK 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS9NP_650889.1 MFS_SLC17 43..461 CDD:340876 13/31 (42%)
SLC37A2NP_938018.1 MFS_SLC37A1_2 22..484 CDD:340902 13/31 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..262
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.