DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or92a and Or98b

DIOPT Version :9

Sequence 1:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:411 Identity:92/411 - (22%)
Similarity:172/411 - (41%) Gaps:57/411 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DELTRFPMTFYKTIGEDLYSDRDPNVIRRYLLRFYLVLGFLNFNAYVVGEIAYFIVHIMSTTTLL 82
            |:..|.....::.:|.:|..::|  |..||..|  .:...|:..:::...||:.:.::.:...|.
  Fly     4 DKFLRLQSALFRLLGLELLHEQD--VGHRYPWR--SICCILSVASFMPLTIAFGLQNVQNVEQLT 64

  Fly    83 EATA------VAPC-IGFSFMADFKQFGLTVNRKRLVRLLDDLKEIFPLDLEAQRKYNVSFYRKH 140
            ::..      :|.| ||. |:..:|.|...:.:...|           |..|...........:.
  Fly    65 DSLCSVLVDLLALCKIGL-FLWLYKDFKFLIGQFYCV-----------LQTETHTAVAEMIVTRE 117

  Fly   141 MNR---VMTLFTILCMTYTSSFSFYPAIKSTIKYYLMGSEIFERNYGFHILFPYDAETDLTVYWF 202
            ..|   :..::....:|...|......:...|.|...|.  .:..:.|..::|:| ...|:.|..
  Fly   118 SRRDQFISAMYAYCFITAGLSACLMSPLSMLISYQRTGE--LQPKFPFPSVYPWD-NMKLSNYII 179

  Fly   203 SY-WGLAHCAYVAGVSY--VCVDLLLIATITQLTMHFNFIANDLEAYEGGDHTD-EENIKYLHNL 263
            || |.:  || ..||:.  ||||.|..:....|...|....:.:..:||.:..: .||:|::..|
  Fly   180 SYFWNV--CA-ALGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHFEGRNTKETHENLKHVFQL 241

  Fly   264 VVYHARALDLSEEVNNIFSFLILWNFIAASLVICFAGFQITASNVEDIVLYFIFFSASLV-QVFV 327
               :|..|:|...:|..|..||. .|:||||.:|...:|::|:.::..:|::..|:|::| ||.:
  Fly   242 ---YALCLNLGHFLNEYFRPLIC-QFVAASLHLCVLCYQLSANILQPALLFYAAFTAAVVGQVSI 302

  Fly   328 VCYYGDEMISSSSRIGHSAFNQNWLPCSTKYKRILQ--FIIARSQKPASIRPPTFPPI------- 383
            .|:.|..:.|.....|.:.:..:|       ..:||  ..:..|.|.|.:|.....||       
  Fly   303 YCFCGSSIHSECQLFGQAIYESSW-------PHLLQENLQLVSSLKIAMMRSSLGCPIDGYFFEA 360

  Fly   384 SFNTFMKVISMSYQFFALLRT 404
            :..|.:.::..:..:..|||:
  Fly   361 NRETLITIVRTAISYVTLLRS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 77/339 (23%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 77/341 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.