DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or92a and Or98a

DIOPT Version :9

Sequence 1:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:368 Identity:67/368 - (18%)
Similarity:135/368 - (36%) Gaps:91/368 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VAPCIGFSFMADFKQFGLTVNRKRLVRLLDDLKEIFPLDL---------EAQRKYNVSFYRKHMN 142
            :..|:.|::.|.:...|:.::.|      .|:....|.:|         .....:.|.|:..:::
  Fly    45 ITSCLIFAWCAVYLPIGIIISFK------TDINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYIS 103

  Fly   143 ------RVMTLFTILCMTYTSSFSFYPAIKSTIKYYLMGSEIFERNYGFHILFPYDAETDLT--- 198
                  ::::.....|.|.......:..:....|.||:        |.| |...|...|.|:   
  Fly   104 GFYKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKAYLI--------YQF-IYTAYTISTFLSAAL 159

  Fly   199 ---VYW-------------FSYWGLAHCAYVAGVSYVCVDLLLIATITQ--------------LT 233
               :.|             .|:|..|          :....|::..:||              |.
  Fly   160 SGKLPWRIYNPFVDFRESRSSFWKAA----------LNETALMLFAVTQTLMSDIYPLLYGLILR 214

  Fly   234 MHFNFIANDLEAY--EGGDHTDEEN----IKYL--HNLVVYHARALDLSEEVNNIFSFLILWNFI 290
            :|...:...:|:.  :.| .:|.||    ||.:  |||::.:|.|:..:........||::...:
  Fly   215 VHLKLLRLRVESLCTDSG-KSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLLIGICL 278

  Fly   291 AASLV--ICFAGFQITASNVEDIVLYFIFFSASLVQVFVVCYYGDEMISSSSRIGHSAFNQNWLP 353
            ..|::  :.||......:.|       .:.:..:||.|..|:..|.:......:..:.|:.||:.
  Fly   279 GLSMINLLFFADIWTGLATV-------AYINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWIN 336

  Fly   354 CSTKYKRILQFIIARSQKPASIRPPTFPPISFNTFMKVISMSY 396
            .|..||..|::.:..:||..:....:..|||..:.:||..:::
  Fly   337 SSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAF 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 67/366 (18%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 61/331 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465988
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.