DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or92a and Or85a

DIOPT Version :9

Sequence 1:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster


Alignment Length:202 Identity:38/202 - (18%)
Similarity:85/202 - (42%) Gaps:20/202 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 VAGV--SYVCVDLLLIATITQLTMHFNFIA-------NDLEAYEGGDHTDEENIKYL--HNLVVY 266
            :||:  :.:.:|:..|..:..|.:|...::       .|:|  :|.|....|.::.:  |.|:|.
  Fly   192 MAGIILANLILDVYPIIYVVVLRIHMELLSERIKTLRTDVE--KGDDQHYAELVECVKDHKLIVE 254

  Fly   267 HARALDLSEEVNNIFSFLILWNFIAASLVICFAGFQITASN-VEDIVLYFIFFSASLVQVFVVCY 330
            :...|      ..:.|..:....::..|::..|...:...| |.:.|:..::..|.|.|.|..||
  Fly   255 YGNTL------RPMISATMFIQLLSVGLLLGLAAVSMQFYNTVMERVVSGVYTIAILSQTFPFCY 313

  Fly   331 YGDEMISSSSRIGHSAFNQNWLPCSTKYKRILQFIIARSQKPASIRPPTFPPISFNTFMKVISMS 395
            ..:::.|....:.::.|:..|:....:|:..:.:.|...|:..........||..||.:|:...:
  Fly   314 VCEQLSSDCESLTNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNTNIKMAKFA 378

  Fly   396 YQFFALL 402
            :....::
  Fly   379 FSVVTIV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 38/194 (20%)
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 38/194 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465975
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.