DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or92a and Or83a

DIOPT Version :9

Sequence 1:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:315 Identity:46/315 - (14%)
Similarity:107/315 - (33%) Gaps:82/315 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 FPLDLEAQRKYNVSFYRKHMNRVMT---------LFTILCMTYTSSFS-FYPAIKSTI--KYYLM 174
            :|.|......|.|.|..:.|.::..         |..:||:..:..:. .:.::|:.:  .|.||
  Fly   182 YPFDYTQPGVYEVVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQYDVLFCSLKNVLASSYVLM 246

  Fly   175 GSEIFERN---------------YGFHILFPYDAETDLTVYWFSYWGLAHCAYVAGVSYVCVDLL 224
            |:.:.|.|               |.:.:    :.||.|.                       :||
  Fly   247 GANMTELNQLQAEQSAADVEPGQYAYSV----EEETPLQ-----------------------ELL 284

  Fly   225 LIATITQLTMHF--NFIANDLEAYEGGDHTDEENIKYLHNLVVYHARALDLSEEVNNIFSFLILW 287
            .:.:....:..|  :|:                      ..:.:|...:...:::.:.:|.:...
  Fly   285 KVGSSMDFSSAFRLSFV----------------------RCIQHHRYIVAALKKIESFYSPIWFV 327

  Fly   288 NFIAASLVICFAGFQITASNVEDIVLYFI----FFSASLVQVFVVCYYGDEMISSSSRIGHSAFN 348
            .....:.::|...|..|.|...:..:..:    :....|.::|::||:.|.:..:|.|.|.:.:.
  Fly   328 KIGEVTFLMCLVAFVSTKSTAANSFMRMVSLGQYLLLVLYELFIICYFADIVFQNSQRCGEALWR 392

  Fly   349 QNWLPCSTKYKRILQFIIARSQKPASIRPPTFPPISFNTFMKVISMSYQFFALLR 403
            ..|.......:....|.:..|::...:.......::.:.|...|:.::.|..||:
  Fly   393 SPWQRHLKDVRSDYMFFMLNSRRQFQLTAGKISNLNVDRFRGTITTAFSFLTLLQ 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 43/306 (14%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 43/306 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.