DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or92a and Or59a

DIOPT Version :9

Sequence 1:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster


Alignment Length:390 Identity:84/390 - (21%)
Similarity:149/390 - (38%) Gaps:79/390 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LGFLNF------NAYVVGEIA-------YFIVHI--------MSTTTLLEATAVAPCIGFSFMAD 98
            ||..:|      |.||...|.       .:.||:        ..|..:|..|..|.|...|....
  Fly    22 LGVAHFRVENWKNLYVFYSIVSNLLVTLCYPVHLGISLFRNRTITEDILNLTTFATCTACSVKCL 86

  Fly    99 FKQFGL--TVNRKRLVRLLDDLKEIFPLDLEAQRKYNVSFY---RKHMNRVMTLFT---ILCMTY 155
            ...:.:  .:..:||:||||: :.:.|    .||    |.|   |..:..|:.:|.   :.|..:
  Fly    87 LYAYNIKDVLEMERLLRLLDE-RVVGP----EQR----SIYGQVRVQLRNVLYVFIGIYMPCALF 142

  Fly   156 TS-SFSFYPAIKSTIKYYLMGSEIFERNYGFHILFPYDAETDLTVYWF----SYWGLAHCAYVAG 215
            .. ||.|..                ||...:...||:|        |.    :|: :|:...:.|
  Fly   143 AELSFLFKE----------------ERGLMYPAWFPFD--------WLHSTRNYY-IANAYQIVG 182

  Fly   216 VSYVCV-----DLLLIATITQLTMHFNFIANDLEAYEGGDHTDEENIKYLHNLVVYHARALDLSE 275
            :|:..:     |......:..::.|...:.|..|  |.|.....:..|.|...:..|...|:|..
  Fly   183 ISFQLLQNYVSDCFPAVVLCLISSHIKMLYNRFE--EVGLDPARDAEKDLEACITDHKHILELFR 245

  Fly   276 EVNNIFSFLILWNFIAASLVICFAGFQITASNVEDIV--LYFIFFSASL-VQVFVVCYYGDEMIS 337
            .:....|..:|..|...:|.:|. |.......|.:.:  :||||:|.:: :|:|..|::|.:...
  Fly   246 RIEAFISLPMLIQFTVTALNVCI-GLAALVFFVSEPMARMYFIFYSLAMPLQIFPSCFFGTDNEY 309

  Fly   338 SSSRIGHSAFNQNWLPCSTKYKRILQFIIARSQKPASIRPPTFPPISFNTFMKVISMSYQFFALL 402
            ...|:.::||:.||...:..:||.:...:.:|.|.::........|..:||...:..:|..|.::
  Fly   310 WFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQSLKKSTAVAGGMMRIHLDTFFSTLKGAYSLFTII 374

  Fly   403  402
              Fly   375  374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 72/336 (21%)
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 73/340 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465806
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.