DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or92a and Or49a

DIOPT Version :9

Sequence 1:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:419 Identity:104/419 - (24%)
Similarity:204/419 - (48%) Gaps:52/419 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DEVITFDELTRFPMTFYKTIGEDLYSDRDPNVIRRYLLRFYLVLGFLNFNAYVVGEIAYFIVHIM 76
            :::.::::........:||:|.||:....|      ..|:.||.|:     :|:..|:.|....|
  Fly     2 EKLRSYEDFIFMANMMFKTLGYDLFHTPKP------WWRYLLVRGY-----FVLCTISNFYEASM 55

  Fly    77 STTTLLEATAVAPC--------IGFSFM--ADFKQFGLTVNRKRLVRLLDDLKEIFPLDLEAQRK 131
            .||.::|..::|..        :.|.:|  :..|.....:|||||::|...|||::|...:.|||
  Fly    56 VTTRIIEWESLAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRK 120

  Fly   132 YNVSFYRKHMNRVMTLFTILCMTYTSSFSFY---------PAIKSTIKYYLMGSEIFERNYGFHI 187
            |.|:.|           .:.|.|....:.:|         |.::|.| .||:|  ..:.::.:..
  Fly   121 YEVNKY-----------YLSCSTRNVLYVYYFVMVVMALEPLVQSCI-MYLIG--FGKADFTYKR 171

  Fly   188 LFP----YDAETDLTVYWFSY-WGLAHCAYVAGVSYVCVDLLLIATITQLTMHFNFIANDLEAYE 247
            :||    :|:|..|. |..:| ....:..::..|| :..||.::...:|::||..::||.|.:..
  Fly   172 IFPTRLTFDSEKPLG-YVLAYVIDFTYSQFIVNVS-LGTDLWMMCVSSQISMHLGYLANMLASIR 234

  Fly   248 GGDHTDEENIKYLHNLVVYHARALDLSEEVNNIFSFLILWN-FIAASLVICFAGFQITASNVEDI 311
            ....|::::..:|.:::..|...:.|.::||.:|..|:..| |..:.|:.|.|.:.:......:.
  Fly   235 PSPETEQQDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEG 299

  Fly   312 VLYFIFFSASLVQVFVVCYYGDEMISSSSRIGHSAFNQNWLPCSTKYKRILQFIIARSQKPASIR 376
            :.|.:.|::...|.:||..:|..:|..|:.:..:||...|...|.:||:.:..::|::|:|..|.
  Fly   300 ISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEIS 364

  Fly   377 PPTFPPISFNTFMKVISMSYQFFALLRTT 405
            ......||.:||..:::::|:|||::|.|
  Fly   365 ARGVIIISLDTFKILMTITYRFFAVIRQT 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 82/340 (24%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 78/311 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472780
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EMAZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.