DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or92a and Or43a

DIOPT Version :9

Sequence 1:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster


Alignment Length:377 Identity:81/377 - (21%)
Similarity:150/377 - (39%) Gaps:74/377 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YLLRFYLVLGFLNFNAYVVGEIAYFIVHIMSTTTLLEATAVAPCIGFSFMADFKQFGLT----VN 107
            ||||.:             |::..||:::                 |.|.|.|.....|    :.
  Fly    49 YLLRMW-------------GDLPAFILNM-----------------FFFSAIFNALMRTWLVIIK 83

  Fly   108 RKRLVRLLDDLKEIFPLDLEAQRKYNVSFYRKHMNRVMTLFTILCMTYTSSFSFYPAIKSTIKYY 172
            |::....|..|..:|...|::..::.....|:.......| .||.:    |.||...:.:.:   
  Fly    84 RRQFEEFLGQLATLFHSILDSTDEWGRGILRRAEREARNL-AILNL----SASFLDIVGALV--- 140

  Fly   173 LMGSEIF--ERNYGFHILFPYDAETDLTVYWFSYWG------LAHCAYVAGVSYVCVDLLLIATI 229
               |.:|  ||.:.|.:..|..:.|...||...|..      |....|:..||......:....:
  Fly   141 ---SPLFREERAHPFGLALPGVSMTSSPVYEVIYLAQLPTPLLLSMMYMPFVSLFAGLAIFGKAM 202

  Fly   230 TQLTMHFNFIANDLEAYEGGDHTDEENIKYLHNLVVYHARAL----DLSEEVNNIFSF-LILWNF 289
            .|:.:|      .|....|.:.::||..:.|.:.:.||.:.:    .|::.|.||.:. .|::..
  Fly   203 LQILVH------RLGQIGGEEQSEEERFQRLASCIAYHTQVMRYVWQLNKLVANIVAVEAIIFGS 261

  Fly   290 IAASLVICFAGFQITASNVEDIVLYFIFFSASLVQVFVV-CYY--GDEMISSSSRIGHSAFNQNW 351
            |..||:.|. ....:.:.|..||:|.      |..::|: .||  .:|:...::|:..:.:|..|
  Fly   262 IICSLLFCL-NIITSPTQVISIVMYI------LTMLYVLFTYYNRANEICLENNRVAEAVYNVPW 319

  Fly   352 LPCSTKYKRILQFIIARSQKPASIRPPTFPPISFNTFMKVISMSYQFFALLR 403
            ....|::::.|...:.::|.|..||.....|::...|..:::.||.:|.:||
  Fly   320 YEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASYSYFTMLR 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 69/335 (21%)
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 71/348 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466125
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.