DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or92a and Or33a

DIOPT Version :9

Sequence 1:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster


Alignment Length:400 Identity:89/400 - (22%)
Similarity:157/400 - (39%) Gaps:73/400 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FDELTRFPMTFYKTIGEDLYSDRDPNVIRRYLLRFYLVLGFLNFNAYVVGEIAYF-IVHIMSTTT 80
            |..|..|.:|.:.||                |...:|:||.     |...:|..| .:|..|   
  Fly    31 FRRLVDFTITSFITI----------------LFPVHLILGM-----YKKPQIQVFRSLHFTS--- 71

  Fly    81 LLEATAVAPCI-----GFSFMADFKQFGLTVNRKRLVRLLDDLKEIFPLDLEAQRKYNVSFYRKH 140
                    .|:     .|.|....|:.      |.:..||.||..  .::.|.:|.|    :.::
  Fly    72 --------ECLFCSYKFFCFRWKLKEI------KTIEGLLQDLDS--RVESEEERNY----FNQN 116

  Fly   141 MNRVMTLFTILCMTYTSSFSFYPAIKSTIKYYLMGSEIFERNYGFHILFPYDAETDLTVYW--FS 203
            .:||..:   |..:|     ...||.:.|...:.|.....||..:...||||.:....:||  ||
  Fly   117 PSRVARM---LSKSY-----LVAAISAIITATVAGLFSTGRNLMYLGWFPYDFQATAAIYWISFS 173

  Fly   204 YWGLAHCAYV----AGVSYVCVDLLLIA-TITQLTMHFNFIANDLEAYEGGDHTDEENIKYLHNL 263
            |..:.....:    |..||..:...::: .:..|.|..:.|.:|::.      :..||.:.|...
  Fly   174 YQAIGSSLLILENLANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKL------SSSENTRKLIEG 232

  Fly   264 VVYHARALDLSEEVNNIFSFLILWNFIAASLVICFAGFQIT--ASNVEDIVLYFIFFSASLVQVF 326
            :..|.:.:.:...:.:......|..|:::.:.|......|.  |.|...::.|.:||:|.|:::|
  Fly   233 IQDHRKLMKIIRLLRSTLHLSQLGQFLSSGINISITLINILFFAENNFAMLYYAVFFAAMLIELF 297

  Fly   327 VVCYYGDEMISSSSRIGHSAFNQNWLPCSTKYKRILQFIIARSQKPASIRPPTFPPISFNTFMKV 391
            ..||||..|.....::.::.|:.|||....:|.|.|..::..:..|.:|:......|..:.|...
  Fly   298 PSCYYGILMTMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFAT 362

  Fly   392 ISMSYQFFAL 401
            :.|:|.|:.|
  Fly   363 VRMAYSFYTL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 71/329 (22%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 75/342 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.