DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or92a and Or10a

DIOPT Version :9

Sequence 1:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:358 Identity:82/358 - (22%)
Similarity:149/358 - (41%) Gaps:55/358 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 MSTTTLLEA-TAVAPCIGFSFMADFKQFGLTVNRKRLVRLLDDLKEIFPLDLEAQRKYNVSFYRK 139
            ::..||..| |:....:....|..|:| .|::...||..||.|.....|...:.:.|::....|.
  Fly    73 LALETLCPAGTSAVTLLKMFLMLRFRQ-DLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARI 136

  Fly   140 HMNRVMTLFTILCMTYT----------------SSFSFYPAIKSTIKYYLMGSEIFERNYGFHIL 188
            :...:...| ..|.||.                ..|.::.....|:...|:       ||.|   
  Fly   137 NFWPLSAGF-FTCTTYNLKPILIAMILYLQNRYEDFVWFTPFNMTMPKVLL-------NYPF--- 190

  Fly   189 FPYDAETDLTVYWFSYWGLAHCAYVAGVSYVCVDLLLIATITQLTMHFNFIANDLEA----YEGG 249
            ||      ||..:.:|.|     ||....:...|.........|:..|..:..::|:    |.  
  Fly   191 FP------LTYIFIAYTG-----YVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYT-- 242

  Fly   250 DHTDEENIKY------LHNLVVYHARALDLSEEVNNIFSFLILWNFIAASLVICFAGFQI--TAS 306
            ||.:...::.      :.::::.|...:||:....:.::.:.|.:|::|::||.|:...:  ..:
  Fly   243 DHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGN 307

  Fly   307 NVEDIVLYFIFFSASLVQVFVVCYYGDEMISSSSRIGHSAFNQNWLPCSTKYKRILQFIIARSQK 371
            |....:||..:..|:|.|:.|.||.|..:..||:.:..:.|:..|.....|.:|::|.:|.|||:
  Fly   308 NGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQR 372

  Fly   372 PASIRPPTFPPISFNTFMKVISMSYQFFALLRT 404
            |.|:..|.|.| |..||..::..|....||:::
  Fly   373 PVSMAVPFFSP-SLATFAAILQTSGSIIALVKS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 79/344 (23%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 79/348 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.