DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or92a and Or69a

DIOPT Version :9

Sequence 1:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:397 Identity:92/397 - (23%)
Similarity:174/397 - (43%) Gaps:64/397 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RDPNVIRRYLLRFYLVLGFLNFNAYVVG--------------EIAYFIVHIMSTTTLLEATAVAP 89
            |...|.|....|....||.:|...:.:|              .|||          |.|..:||.
  Fly    28 RSLEVKRNLAKRIIFWLGAVNLVYHNIGCVMYGYFGDGRTKDPIAY----------LAELASVAS 82

  Fly    90 CIGFSFMADFKQFGLTVNRKRLVRLLDDLKEIFPLDLEAQRKYNVSFYR-KHMNRVMTLFTILCM 153
            .:||:.:.....:.:...:.....||::.:|:|  .|...|.|.:..|: |:...:...|    :
  Fly    83 MLGFTIVGTLNLWKMLSLKTHFENLLNEFEELF--QLIKHRAYRIHHYQEKYTRHIRNTF----I 141

  Fly   154 TYTSSFSFYPAIKSTIKYYLMGSEIF--ERNYGFHI----LFPYDAETDLTVYWFSYWGLAHCAY 212
            .:||:..:|    :::...||..|.|  .:..|:.|    .:|:..:..:.    .::....|..
  Fly   142 FHTSAVVYY----NSLPILLMIREHFSNSQQLGYRIQSNTWYPWQVQGSIP----GFFAAVACQI 198

  Fly   213 VAGVSYVCVDLLLIATIT----QLTMHFNFIANDLEAYEGGDHTDEENIKYLHNLVVYHARALDL 273
            .:..:.:||::.:...|.    ||.:||:.:|..||..:..:...::.:||   |:|||.:.|:|
  Fly   199 FSCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLETIDARNPHAKDQLKY---LIVYHTKLLNL 260

  Fly   274 SEEVNNIFSFLILWNFIAASLVICFAGFQIT----ASNVEDI--VLYFIFFSASLVQVFVVCYYG 332
            ::.||..|:|..|.:...:.:..||..|.:|    .::::.:  :|.||.::      |.:|..|
  Fly   261 ADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLKHLLGLLLFITYN------FSMCRSG 319

  Fly   333 DEMISSSSRIGHSAFNQNWLPCSTKYKRILQFIIARSQKPASIRPPTFPPISFNTFMKVISMSYQ 397
            ..:|.:|.::..:||..||......|:|:|..::.|:.||...:.....|:|..|:|..:..|||
  Fly   320 THLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQ 384

  Fly   398 FFALLRT 404
            .|..:|:
  Fly   385 MFTCVRS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 76/332 (23%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 76/331 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472759
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.