powered by:
Protein Alignment CG46441 and CG6893
DIOPT Version :9
Sequence 1: | NP_001369026.1 |
Gene: | CG46441 / 42423 |
FlyBaseID: | FBgn0287211 |
Length: | 96 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001369058.1 |
Gene: | CG6893 / 40038 |
FlyBaseID: | FBgn0036807 |
Length: | 291 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 15/66 - (22%) |
Similarity: | 22/66 - (33%) |
Gaps: | 32/66 - (48%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 LVETGNK--DKPKGAAWIIIMVILLNACLIALAFPLYLYLNSVDEVVKKRLMDYCIVGGGLIGIP 78
|.|.|.: |.|.| ||:..|:| .:..|: .|::|.|
Fly 88 LYEMGKEHLDDPAG---------LLDKVLVA-------------------ALAGCV--AGVVGTP 122
Fly 79 M 79
|
Fly 123 M 123
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S759 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.