DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG46441 and CG6893

DIOPT Version :9

Sequence 1:NP_001369026.1 Gene:CG46441 / 42423 FlyBaseID:FBgn0287211 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:66 Identity:15/66 - (22%)
Similarity:22/66 - (33%) Gaps:32/66 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVETGNK--DKPKGAAWIIIMVILLNACLIALAFPLYLYLNSVDEVVKKRLMDYCIVGGGLIGIP 78
            |.|.|.:  |.|.|         ||:..|:|                   .:..|:  .|::|.|
  Fly    88 LYEMGKEHLDDPAG---------LLDKVLVA-------------------ALAGCV--AGVVGTP 122

  Fly    79 M 79
            |
  Fly   123 M 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG46441NP_001369026.1 None
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 3/7 (43%)
Mito_carr 98..192 CDD:395101 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.