DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG46441 and Slc25a10

DIOPT Version :9

Sequence 1:NP_001369026.1 Gene:CG46441 / 42423 FlyBaseID:FBgn0287211 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_038798.2 Gene:Slc25a10 / 27376 MGIID:1353497 Length:287 Species:Mus musculus


Alignment Length:30 Identity:9/30 - (30%)
Similarity:13/30 - (43%) Gaps:8/30 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LLNACLIALAFPLYLYLNSVDEVVKKRLMD 66
            :...|...|..||        :|:|.|||:
Mouse   207 IAGGCATFLCQPL--------DVLKTRLMN 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG46441NP_001369026.1 None
Slc25a10NP_038798.2 Solcar 1 7..87
Mito_carr 12..92 CDD:278578
Mito_carr 94..189 CDD:278578
Solcar 2 100..187
Solcar 3 196..279 9/30 (30%)
Mito_carr 197..283 CDD:278578 9/30 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.