DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g2 and EIF3G2

DIOPT Version :9

Sequence 1:NP_650887.1 Gene:eIF3g2 / 42422 FlyBaseID:FBgn0038796 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_196219.3 Gene:EIF3G2 / 830487 AraportID:AT5G06000 Length:308 Species:Arabidopsis thaliana


Alignment Length:293 Identity:107/293 - (36%)
Similarity:154/293 - (52%) Gaps:37/293 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KTFVTSWA--DEVDADYVDGLPPSNEYIKGD---FKYVTEYKFNDDGKKVKVVRTFKIEKQIVPK 61
            ||....|.  ||.:.|| |.|.|..:.|..|   .|.|.|||||::.||||:..|.:::|:.:.|
plant     8 KTKKLRWGEIDEEEGDY-DFLLPPKQMISPDQNGVKKVIEYKFNEEDKKVKITTTTRVQKRALTK 71

  Fly    62 AVARRRNWVKFGDSRSDKPGPNSQTTMAS-EEIFMQFIGSKDFDQTHET-------QL-DPGKNI 117
            ....||:|.||||:..::  .:|..||.| |:|.::.|.:...:....|       || .||..:
plant    72 QAVERRSWNKFGDAAHEE--SSSYLTMRSTEDIILERIRAPGSNAEQSTVSGDSMSQLGKPGAVL 134

  Fly   118 AKCRIC--NGEHWSVNCPYKG--TSMDSKTVMETKANAAAAAAISDPSKTGK--YVPPFMKDGGG 176
            ..||:|  .|:||:..||.|.  :.||.....||..:....        ||:  ||||.|::|..
plant   135 MVCRLCQKKGDHWTSRCPQKDLLSLMDEPLTAETSTSTITG--------TGRAAYVPPSMREGAD 191

  Fly   177 --ISGSKNWGRGRDRDDSSAVRISNLSESMTETDLEELVKKIGPHTKMYLAREKNSGLCKGFAYV 239
              ..||..    |.|.|.::||::||||.....||.||.:..|..|:.::|.::.:.:.:||.:|
plant   192 RKAGGSDM----RSRHDENSVRVTNLSEDTRGPDLMELFRPFGAVTRCHVAIDQKTSMSRGFGFV 252

  Fly   240 HFKFRQDAAAAIEVLNGHGYDHLILCVEWSKPQ 272
            .|..|:||..||..|||:|||:|||.||||.|:
plant   253 SFVSREDAQRAINKLNGYGYDNLILRVEWSTPK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g2NP_650887.1 eIF3g 28..137 CDD:289149 43/124 (35%)
RRM <171..>256 CDD:223796 30/86 (35%)
RRM_eIF3G_like 194..270 CDD:240854 34/75 (45%)
EIF3G2NP_196219.3 eIF3g 36..157 CDD:289149 43/122 (35%)
RRM <187..>287 CDD:223796 42/103 (41%)
RRM_eIF3G_like 207..282 CDD:240854 33/74 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3145
eggNOG 1 0.900 - - E1_KOG0122
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I1585
OMA 1 1.010 - - QHG55427
OrthoDB 1 1.010 - - D1226059at2759
OrthoFinder 1 1.000 - - FOG0003558
OrthoInspector 1 1.000 - - mtm1122
orthoMCL 1 0.900 - - OOG6_102687
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2433
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.