DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g2 and Rox8

DIOPT Version :9

Sequence 1:NP_650887.1 Gene:eIF3g2 / 42422 FlyBaseID:FBgn0038796 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:245 Identity:59/245 - (24%)
Similarity:90/245 - (36%) Gaps:50/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IEKQIVPKAVARRRNWVKFGDSRSDKPGPNSQTTMAS-EEIFMQFIGSKDFDQTHETQLDPGKNI 117
            :||:|       :.||       :..||...:|.::| ..||:..:..:...:|......|...|
  Fly    71 LEKEI-------KVNW-------ATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEI 121

  Fly   118 AKCRICNGEHWSVNCPYKGTSMDSKTVMETKANAAAAAAISDPS-----KTGKYVPP-FMKDGGG 176
            :.|||....|...:..|...|...|...|....|.....|...|     .|.|..|| ....|||
  Fly   122 SNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGG 186

  Fly   177 ISGSKNWGRGRDRDDSSAVR-----ISNLSESMTETDL-----------EELVKK----IGPHTK 221
            ..|....|.|.......:.|     :.|.| |.|.|.:           ::|:.|    .||...
  Fly   187 QGGGMGGGPGNGSGVKGSQRHTFEEVYNQS-SPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQD 250

  Fly   222 MYLAREKNSGLCKGFAYVHFKFRQDAAAAIE-VLNGHGYDHLILCVEWSK 270
            :.:.::      |||:::.|..::.||.||| ..|...:.:|:.|. |.|
  Fly   251 VRVFKD------KGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCF-WGK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g2NP_650887.1 eIF3g 28..137 CDD:289149 19/83 (23%)
RRM <171..>256 CDD:223796 25/105 (24%)
RRM_eIF3G_like 194..270 CDD:240854 23/96 (24%)
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 51/223 (23%)
RRM1_TIA1_like 9..80 CDD:240798 5/22 (23%)
RRM2_TIA1_like 96..170 CDD:240799 16/73 (22%)
RRM3_TIA1_like 221..294 CDD:240800 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.