DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g2 and elav

DIOPT Version :9

Sequence 1:NP_650887.1 Gene:eIF3g2 / 42422 FlyBaseID:FBgn0038796 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster


Alignment Length:137 Identity:33/137 - (24%)
Similarity:61/137 - (44%) Gaps:19/137 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 AAAAISDPSKTGKYVPPFMK-----DGGGISGSKNWGRGRDRDDSSAVRISNLSESMTETDLEEL 212
            |||.:...:.....||...:     :|...|||:|...|.....::.: ::.|.::|||.::..|
  Fly   105 AAAVVQQAAVQQAVVPQPQQAQPNTNGNAGSGSQNGSNGSTETRTNLI-VNYLPQTMTEDEIRSL 168

  Fly   213 VKKIGPHTKMYLAREK-------------NSGLCKGFAYVHFKFRQDAAAAIEVLNGHGYDHLIL 264
            ...:|....:.|.|:|             :.|...|:.:|::...|||..|:.||||....:..:
  Fly   169 FSSVGEIESVKLIRDKSQVYIDPLNPQAPSKGQSLGYGFVNYVRPQDAEQAVNVLNGLRLQNKTI 233

  Fly   265 CVEWSKP 271
            .|.:::|
  Fly   234 KVSFARP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g2NP_650887.1 eIF3g 28..137 CDD:289149
RRM <171..>256 CDD:223796 24/102 (24%)
RRM_eIF3G_like 194..270 CDD:240854 21/88 (24%)
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 22/96 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.