DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4335 and JLP1

DIOPT Version :9

Sequence 1:NP_650886.1 Gene:CG4335 / 42421 FlyBaseID:FBgn0038795 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_013043.1 Gene:JLP1 / 850669 SGDID:S000003980 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:393 Identity:76/393 - (19%)
Similarity:127/393 - (32%) Gaps:137/393 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LDLPADIMPLDVKYDGMNLQVQWSDAHKSNYDLDFIFDSQ----------LERLIGRRSKSTNLT 96
            :.||:..:|:.:..:|:......|.....|:|..| :|.|          :.:....:||..:..
Yeast    10 IPLPSTDLPVKIITNGLKNLNYTSKQGYGNFDTHF-YDGQDEVSPSGLLKIRKSYREKSKYPDYL 73

  Fly    97 P-WNRSIILQNERH--LRF------------PLPQLVSSDN----EVRSLVESL-VRYGIVFIDD 141
            | |:     ..|::  |.|            ....|.:.:|    :|:.:...| :....:.:.|
Yeast    74 PTWD-----PTEKYGPLEFHEYHDPALRADGNFSNLFAKENVGQLKVKKITPKLGLEINGIQLTD 133

  Fly   142 VAPTANMTELALRRVFPLMKTFFGEMWTFSD-NPDHADTAY----TKLYL--------------- 186
            ::..|. .||||......:..|..:  .|:| .||:. |.|    .||::               
Yeast   134 LSDAAK-DELALLVAQKGVVVFRNQ--NFADEGPDYV-TEYGRHFGKLHIHQTSGHPQNNPELHI 194

  Fly   187 ---------------------GSHTDNTYFCDAAGLQALHCIEHSGSGGENFFVD---------- 220
                                 |.|||.:|............:|....||:..|.|          
Yeast   195 TFRRPDAEEFARVFDDSTSSGGWHTDVSYELQPPSYTFFSVVEGPDGGGDTLFADTIEAFDRLSK 259

  Fly   221 -------GLHVVHE-------------LKRRYPAAYDVLCSVQVPGEYIEKGEHHYHTAPIIQVD 265
                   .|||:|.             :|||.|..                   |.|  |:::|.
Yeast   260 PLQDFLSTLHVIHSSKEQAENSQRQGGIKRRAPVT-------------------HIH--PLVRVH 303

  Fly   266 PLTQEFVQLRLNVYDRAVFNTIPQAEMAEFYDSLRQLLLIVRDKQQ-QWALKLCPGSIVLFDNWR 329
            |:.::    :....:||....|.:.:..|....|..|..:|..... |...|..|.|:|::||.|
Yeast   304 PVLKK----KCLYVNRAFSRKIVELKRQESESLLNFLYNLVESSHDLQLRAKWEPHSVVIWDNRR 364

  Fly   330 VLH 332
            |.|
Yeast   365 VQH 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4335NP_650886.1 carnitine_TMLD 19..361 CDD:274119 76/393 (19%)
DUF971 <19..70 CDD:294847 5/27 (19%)
CAS_like 110..350 CDD:294121 61/312 (20%)
JLP1NP_013043.1 TauD 112..396 CDD:225086 57/285 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.