DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4335 and BBOX1

DIOPT Version :9

Sequence 1:NP_650886.1 Gene:CG4335 / 42421 FlyBaseID:FBgn0038795 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001363187.1 Gene:BBOX1 / 8424 HGNCID:964 Length:387 Species:Homo sapiens


Alignment Length:367 Identity:100/367 - (27%)
Similarity:171/367 - (46%) Gaps:45/367 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WLRDHCRCVECLNFETNQRRYDVLDLPADIMPLDVKYDGMNLQVQWSDAHKSNYDLDFIFDSQLE 83
            ||||:|.|.:|.......|:..|..|..:|....:.:|...:.:.|.|.|.|.:..|::    .:
Human    33 WLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWL----KK 93

  Fly    84 RLIGRRSKSTNLTPWNRSIILQNERHLRFPLPQLVSSDNEVRSL-VESLVRY------------- 134
            |...:::::            :.:|.|.||..|...|:.::.:| .|.::||             
Human    94 RCFSKQARA------------KLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKK 146

  Fly   135 -GIVFIDDVA-PTANMTELALRRVFPLMKTFFGEMWTFSDNPDHADTAYTKLYLGSHTDNTYFCD 197
             |||.:...: ....:::|..|..| |..||:|..|...|..|..:.|||...|..|||......
Human   147 VGIVRLTGASDKPGEVSKLGKRMGF-LYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHH 210

  Fly   198 AAGLQALHCIEHSGSGGENFFVDGLHVVHELKRRYPAAYDVLCS-----VQVPGEYIEKGEHHYH 257
            ..|:|.||||:.:.:||::..|||.:|..:||:..|.|:.:|.|     ..:..:|.:......|
Human   211 PPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKH 275

  Fly   258 TAPIIQVDPLTQEFVQLRLNVYDRAVFNTIPQAEMAEFYDSLRQLLLIVRDKQQQWALKLCPGSI 322
              .||::|...| .|::..|...|.....:|...:..||.:|::.:.::..|:.::..|:.||.:
Human   276 --KIIELDDKGQ-VVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDV 337

  Fly   323 VLFDNWRVLHGREAYTG----SRTMSGSYVQRTDFLSKARVL 360
            :.|||||:||||.:|..    ||.:.|:|......:|:.|:|
Human   338 ITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRIL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4335NP_650886.1 carnitine_TMLD 19..361 CDD:274119 100/367 (27%)
DUF971 <19..70 CDD:294847 15/50 (30%)
CAS_like 110..350 CDD:294121 78/264 (30%)
BBOX1NP_001363187.1 carnitine_bodg 16..381 CDD:274118 100/367 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D534559at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2023
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.