DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4335 and AT3G21360

DIOPT Version :9

Sequence 1:NP_650886.1 Gene:CG4335 / 42421 FlyBaseID:FBgn0038795 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_188773.1 Gene:AT3G21360 / 821690 AraportID:AT3G21360 Length:330 Species:Arabidopsis thaliana


Alignment Length:403 Identity:75/403 - (18%)
Similarity:133/403 - (33%) Gaps:162/403 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ECLNFET---NQRRYDVLDLPADIMP--LDVKYDGMNLQVQWSDAHKSNYDLDFIFDSQLERLIG 87
            |.|..||   .|:.|:....||.|.|  ..:....::|.:.........:.||            
plant     3 ELLLVETPIPQQKHYESKPFPAVISPPSASIPIPALSLPLFTQTIKTQKHYLD------------ 55

  Fly    88 RRSKSTNLTPWNRSIILQNERHLRFPLPQLVSSDNEVRSLVESLVRYGIVFIDDVAPTANMTELA 152
                  :|...:.:::.:.     ||    |:|.::...:||:.....:.::...||..::.   
plant    56 ------SLLHESGAVLFRG-----FP----VNSADDFNDVVEAFGFDELPYVGGAAPRTSVV--- 102

  Fly   153 LRRVFPLMKTFFGEMWTFSDNPD------HADTAY-----TKLYLGSHTDNTYFCDAAGLQALHC 206
                        |.::|.:::|.      |.:.|.     :||:        ::|:         
plant   103 ------------GRVFTANESPPDQKIPFHHEMAQVREFPSKLF--------FYCE--------- 138

  Fly   207 IEHSGSGGENFFVDGLHVVHE-LKRRYPAAYDVLCSVQVPGEYIEKGEHHYHTAPIIQV------ 264
            ||.. .|||...|.. |||:| :|.::|             |::::.|.|    .::.|      
plant   139 IEPK-CGGETPIVLS-HVVYERMKDKHP-------------EFVQRLEEH----GLLYVRVLGED 184

  Fly   265 -DP------------LT-------QEFVQLRLNV-------------------YD-----RAVFN 285
             ||            ||       |..|.|.:.:                   ||     :..||
plant   185 DDPSSPIGRGWKSTFLTHDKNLAEQRAVDLGMKLEWTEDGGAKTVMGPIPAIKYDESRNRKVWFN 249

  Fly   286 TIPQA------------EMAEFYDSLRQLLLIVRD-----KQQQWALKLCPGSIVLFDNWRVLHG 333
            ::..|            :...|.|.......||.|     :::..|:....|.::|.|||.|||.
plant   250 SMVAAYTGWEDKRNDPRKAVTFGDGKPLPADIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHS 314

  Fly   334 REAYTGSRTMSGS 346
            |..:...|.:..|
plant   315 RRPFDPPRRVLAS 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4335NP_650886.1 carnitine_TMLD 19..361 CDD:274119 75/403 (19%)
DUF971 <19..70 CDD:294847 11/46 (24%)
CAS_like 110..350 CDD:294121 61/316 (19%)
AT3G21360NP_188773.1 CAS_like 14..330 CDD:294121 71/392 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D868657at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.