DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4335 and Bbox1

DIOPT Version :9

Sequence 1:NP_650886.1 Gene:CG4335 / 42421 FlyBaseID:FBgn0038795 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_072151.1 Gene:Bbox1 / 64564 RGDID:619756 Length:387 Species:Rattus norvegicus


Alignment Length:364 Identity:97/364 - (26%)
Similarity:167/364 - (45%) Gaps:39/364 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WLRDHCRCVECLNFETNQRRYDVLDLPADIMPLDVKYDGMNLQVQWSDAHKSNYDLDFIFDSQLE 83
            ||||:|:|.:|.......|:..:..|..:|...|:.:|...:.:.|.:.|.|.::.:::    .:
  Rat    33 WLRDNCQCSDCYLHSAKARKLLLEALDVNIRMDDLTFDQKKVYITWPNGHYSEFEANWL----KK 93

  Fly    84 RLIGRRSKSTNLTPWNRSIILQNERHL--------RFPLPQL-----VSSDNEVRSLVESLVRYG 135
            |...:.:::.          ||.|..|        ...||.|     ::.|:.....:.||.:.|
  Rat    94 RCFSQEARAG----------LQGELFLPECQYWGSELQLPTLNFEDVLNDDDHAYKWLSSLKKVG 148

  Fly   136 IVFIDDVAPTANMTELALRRVFPLMKTFFGEMWTFSDNPDHADTAYTKLYLGSHTDNTYFCDAAG 200
            ||.:...|..........:|:..|..||:|..|...|..|..:.|||...|..|||........|
  Rat   149 IVRLTGAADKRGEIIKLGKRIGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPG 213

  Fly   201 LQALHCIEHSGSGGENFFVDGLHVVHELKRRYPAAYDVLCS-----VQVPGEYIEKGEHHYHTAP 260
            :|.||||:.:.:||::..|||.:|..:||.:.|.|:.:|.|     ..:..:|.:......|  .
  Rat   214 VQLLHCIKQTVTGGDSEIVDGFNVCQKLKEKNPQAFSILSSTFVDFTDIGVDYCDFSVQSKH--K 276

  Fly   261 IIQVDPLTQEFVQLRLNVYDRAVFNTIPQAEMAEFYDSLRQLLLIVRDKQQQWALKLCPGSIVLF 325
            ||::|...| .|::..|...|.....:|...:..||.:|::.:.::..|:.::..|:.||.::.|
  Rat   277 IIELDDKGQ-VVRINFNNATRDTVFDVPIERVQPFYAALKEFVDLMNSKEYKYTFKMNPGDVITF 340

  Fly   326 DNWRVLHGREAYTG----SRTMSGSYVQRTDFLSKARVL 360
            ||||:||||.:|..    ||.:.|:|......:|:.|:|
  Rat   341 DNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRIL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4335NP_650886.1 carnitine_TMLD 19..361 CDD:274119 97/364 (27%)
DUF971 <19..70 CDD:294847 14/50 (28%)
CAS_like 110..350 CDD:294121 75/261 (29%)
Bbox1NP_072151.1 CAS_like 16..381 CDD:412204 97/364 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D534559at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.