DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4335 and bbox1

DIOPT Version :9

Sequence 1:NP_650886.1 Gene:CG4335 / 42421 FlyBaseID:FBgn0038795 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_005168960.1 Gene:bbox1 / 572649 ZFINID:ZDB-GENE-050417-218 Length:433 Species:Danio rerio


Alignment Length:379 Identity:105/379 - (27%)
Similarity:179/379 - (47%) Gaps:69/379 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WLRDHCRCVECLNFETNQRR---YDVLDLPADIMPLDVKYDGMN--------LQVQWSDAHKSNY 72
            ||||:|:|..| ..::.|.|   :..||:          :.||:        :.:.|.|.|.|.:
Zfish    79 WLRDNCQCPLC-TLQSAQARSLLFSHLDV----------HTGMDHVQLMDNKVSITWPDQHSSEF 132

  Fly    73 DLDFI----FDSQLERLIGRRSKSTNLTPWNRSIILQNERH-----LRFP---LPQLVSSDNEVR 125
            |.|::    |.|:..:.:             :..:..|||.     |:.|   ..:::..|....
Zfish   133 DPDWLKKRCFSSEARQAL-------------QEELFLNEREYWDSGLQIPTADFEEVLHDDKAAL 184

  Fly   126 SLVESLVRYGIVFIDDVAPTANMTELA--LRRVFPLMKTFFGEMWTFSDNPDHADTAYTKLYLGS 188
            :.:|:|.|.|||::.. || |...:||  .:|:..|..||:|..|...|.|...:.|||...|..
Zfish   185 AWLEALRRIGIVYLRG-AP-AEQGQLARLSQRIGYLRLTFYGHTWQVQDKPMANNVAYTSGELSL 247

  Fly   189 HTDNTYFCDAAGLQALHCIEHSGSGGENFFVDGLHVVHELKRRYPAAYDVLCSVQVP-----GEY 248
            |||........|:|.|||:..:..|||:..|||.|:..:|:|..|.|:::|.|::|.     .:|
Zfish   248 HTDYPALHHPPGVQFLHCVRQADEGGESEVVDGFHMAEQLRREDPEAFNILSSLRVDFTDSGADY 312

  Fly   249 IE---KGEHHYHTAPIIQVDPLTQEFVQLRLNVYDRAVFNTIPQAEMAEFYDSLRQLLLIVRDKQ 310
            .:   :.::|     ||.||. :...|::..|...|.....:|..::..||.||:..:.::...:
Zfish   313 CDFSVQSKNH-----IIDVDS-SGRVVRINYNNATRDSVLDLPLHQVQPFYSSLKAFVELLSRPE 371

  Fly   311 QQWALKLCPGSIVLFDNWRVLHGREAYTGS----RTMSGSYVQRTDFLSKARVL 360
            ..:..::.||.:|.|||||:||||::|...    |.:.|:|:...:.:|:.|:|
Zfish   372 NVFTYRMEPGDVVTFDNWRLLHGRKSYQSRGQNLRHLEGAYLDWDEVMSRLRIL 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4335NP_650886.1 carnitine_TMLD 19..361 CDD:274119 105/379 (28%)
DUF971 <19..70 CDD:294847 16/61 (26%)
CAS_like 110..350 CDD:294121 78/256 (30%)
bbox1XP_005168960.1 TauD 62..426 CDD:331497 105/379 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D534559at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.