powered by:
Protein Alignment MtnC and MtnB
DIOPT Version :9
Sequence 1: | NP_650882.1 |
Gene: | MtnC / 42416 |
FlyBaseID: | FBgn0038790 |
Length: | 43 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001287425.1 |
Gene: | MtnB / 42424 |
FlyBaseID: | FBgn0002869 |
Length: | 43 |
Species: | Drosophila melanogaster |
Alignment Length: | 43 |
Identity: | 35/43 - (81%) |
Similarity: | 39/43 - (90%) |
Gaps: | 0/43 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MVCKGCGTNCKCQDTKCGDNCACNQDCKCVCKNGPKDQCCKSK 43
||||||||||:|...|||||||||:||:||||||||||||.:|
Fly 1 MVCKGCGTNCQCSAQKCGDNCACNKDCQCVCKNGPKDQCCSNK 43
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4738 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0012716 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X10540 |
|
4 | 3.810 |
|
Return to query results.
Submit another query.