powered by:
Protein Alignment MtnC and MtnA
DIOPT Version :9
Sequence 1: | NP_650882.1 |
Gene: | MtnC / 42416 |
FlyBaseID: | FBgn0038790 |
Length: | 43 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262438.1 |
Gene: | MtnA / 41202 |
FlyBaseID: | FBgn0002868 |
Length: | 40 |
Species: | Drosophila melanogaster |
Alignment Length: | 40 |
Identity: | 16/40 - (40%) |
Similarity: | 18/40 - (45%) |
Gaps: | 4/40 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MVCKGCGTNCKCQDTKCGDNCACNQDCKCVCKNGPKDQCC 40
|.|. ||:.|||.......:|.|..|||| .|.|...|
Fly 1 MPCP-CGSGCKCASQATKGSCNCGSDCKC---GGDKKSAC 36
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4738 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.