DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MtnC and MtnA

DIOPT Version :9

Sequence 1:NP_650882.1 Gene:MtnC / 42416 FlyBaseID:FBgn0038790 Length:43 Species:Drosophila melanogaster
Sequence 2:NP_001262438.1 Gene:MtnA / 41202 FlyBaseID:FBgn0002868 Length:40 Species:Drosophila melanogaster


Alignment Length:40 Identity:16/40 - (40%)
Similarity:18/40 - (45%) Gaps:4/40 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVCKGCGTNCKCQDTKCGDNCACNQDCKCVCKNGPKDQCC 40
            |.|. ||:.|||.......:|.|..||||   .|.|...|
  Fly     1 MPCP-CGSGCKCASQATKGSCNCGSDCKC---GGDKKSAC 36

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtnCNP_650882.1 Metallothio_5 1..41 CDD:280273 16/40 (40%)
MtnANP_001262438.1 Metallothio_5 1..40 CDD:280273 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4738
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.