DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir92a and Ir7d

DIOPT Version :9

Sequence 1:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster


Alignment Length:307 Identity:61/307 - (19%)
Similarity:103/307 - (33%) Gaps:91/307 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 ELYPNKLLNLQRRSLLVGSITYVPYTITNYVPAGQGDVDPIHPQWPNRSLTFDGAEANVMKTFCQ 297
            :::|.:|.||....|.|     :.:.|..|:.......||:.        ..||.:..:::...:
  Fly   198 DVFPRRLKNLHGCPLSV-----IVWDIPPYMRINWKSSDPMD--------GLDGLDGLLLRIVAR 249

  Fly   298 VHNCHLRV---EAYGADNWGGIYDNESSDGMLGDIYEQRVEMAIGCIYNWYDGIT--ETSHTIAR 357
            ..|..|::   |..|... |..:.|.:..|....:.|:|..:.|||.....:..|  |.:...::
  Fly   250 KMNFTLKLIPNEPNGLIG-GSSFMNGTFTGAYKMLRERRANITIGCAACTPERSTFLEATSPYSQ 313

  Fly   358 SSVTILGPAPAPLPSWRTNIMPFNNRAWLVLISTL---------------VICGTFLY-FMKYVS 406
            .|..|:..|......:...:.||....||:|.:.|               ::.|..|: |:...|
  Fly   314 MSYIIVLQARGGYSIYEVMLFPFEKYTWLLLSTILGLHWIVGSRWRMPSPILAGWMLWIFVIRAS 378

  Fly   407 YRLRYSGTQVKFHHSRKLEKSMLDIFALFIQ-QPSAPLSFDRFAPRFFLATILCATITLENIYSG 470
            |                 |.|:.:    ||| .|..|      :||           ||:...||
  Fly   379 Y-----------------EASVFN----FIQNSPVKP------SPR-----------TLDQALSG 405

  Fly   471 ---------QLKSMLTFPFYSA--------PVDTIEKWAQSGWKWSA 500
                     ..:..|..|.:..        |||..:...::.||..|
  Fly   406 GFRFITDHASYRMTLKIPSFQGKTLISAGQPVDVFDALLKAPWKTGA 452



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463032
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.