DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir92a and grin3ba

DIOPT Version :9

Sequence 1:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster
Sequence 2:XP_021323058.1 Gene:grin3ba / 566411 ZFINID:ZDB-GENE-070912-354 Length:1118 Species:Danio rerio


Alignment Length:508 Identity:96/508 - (18%)
Similarity:172/508 - (33%) Gaps:139/508 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 LLVGSITYVPYTITNYV------PAGQGDVDP-------IHPQWPNRSLTFDGAEANVMKTFCQ- 297
            |.|.::...|:..|..|      ||||..:||       ::..:.....|...:....|:..|. 
Zfish   458 LRVVTLVEHPFVFTREVDEEGQCPAGQLCLDPQTNNSEVLNQLFRELEQTNSSSLPTDMRKCCYG 522

  Fly   298 ---------VHNCHLRVEAY-GADNWGGIYDNESSDGMLGDIYEQRVEMAIGCIYNWYDGITETS 352
                     ..:.|...:.| ..|...|.:......|::||:.....:||          :|..|
Zfish   523 YCIDLLEKLAEDMHFEFDLYIVGDGKYGAWKGGRWSGLVGDLLSGVADMA----------VTSFS 577

  Fly   353 HTIARSSV---------TILG------PAPAPLPSWRTNIMPFNNRAWLVLISTLVICGTFLYFM 402
            ...|||.|         |.||      ...||:.::   :.|.:...|:.:...|.|...|:...
Zfish   578 INSARSRVIDFTSPFFSTSLGILVRSKDTAAPIGAF---MWPLHWSMWVGIFVALHITALFITLY 639

  Fly   403 KYVS---------YRLRYSGTQVKFHHSRKLEKSMLDIFALFIQQPSAPLSFDRFAPRFFLATIL 458
            ::.|         .|:|.      |.:|..|......:|...:...:......||...  |..|.
Zfish   640 EWNSPFGMTPHGRNRIRV------FSYSSALNLCYAILFGRTVASKTPKCWTGRFLMN--LWAIF 696

  Fly   459 CATITLENIYSGQLKSML----TFPFYSAPVDTIEKWAQSGWKWSAPSIIWVHTVQSSDLETEQI 519
            |..:.  :.|:..|.:::    ||...|...|........|:::.        ||:.|  ..|..
Zfish   697 CLLVL--SSYTANLAAVMVGEKTFEEVSGIHDVKLHHPSLGFRFG--------TVRES--SAEDY 749

  Fly   520 LARNF-EVHDYSYLSNVSFMPNYGFGIERLSSGSLSVGDYVSTEALENRIVLHDDLYFDYTRAV- 582
            :.::| |:|:|....|....|:   |:..|.:....:..::..:||           .||..:: 
Zfish   750 VKKSFPEMHEYMRRFNKPTTPD---GVSTLKTDPPQLDAFIMDKAL-----------LDYEVSID 800

  Fly   583 ------------SIRGW-ILMPELNKHIRTCQETGLYFHWELEFIDKYMDKKKQEVLMDLAN--- 631
                        :|.|: |.:|:.:...|.              :.:|:.:.|.:..||:.:   
Zfish   801 ADCKLLTVGKPFAIEGYGIGLPQNSPLTRN--------------VSEYVSRYKSDGYMDMLHDKW 851

  Fly   632 ------GHKVKGAPQALD--VRNIAGALFVLAFGVAFAGCALVAELLIHRMDL 676
                  |.:|....:.|.  :::.:|...:|..|||.|...|:.|....|..|
Zfish   852 YKVVPCGKRVFAVTETLQMGIQHFSGLFVLLCVGVAGALLTLLGEHAFFRFIL 904

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir92aNP_001097845.2 None
grin3baXP_021323058.1 Periplasmic_Binding_Protein_Type_1 26..428 CDD:324556
PBP2_iGluR_NMDA_Nr3 457..852 CDD:270438 83/454 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591703
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.