DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir92a and grin3a

DIOPT Version :9

Sequence 1:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster
Sequence 2:XP_009303361.1 Gene:grin3a / 564832 ZFINID:ZDB-GENE-130530-780 Length:1111 Species:Danio rerio


Alignment Length:516 Identity:99/516 - (19%)
Similarity:181/516 - (35%) Gaps:134/516 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 LYPNKLLNLQRRS-------------LLVGSITYVPYTITNYV------PAGQGDVDPIHPQWPN 279
            ::|||     |||             |.|.::...|:..|..|      ||||..:||:......
Zfish   500 VWPNK-----RRSQPGADWRHSSRLHLRVVTLVEHPFVFTRDVDDEGLCPAGQLCLDPLTNDTAL 559

  Fly   280 RSLTFDGAEANVMKTFCQVHNCHLRVEAYG---------ADNWG-------------GIYDNESS 322
            ....|.|.:........:...|     .||         |::.|             |.|.|...
Zfish   560 LESLFQGLQGANDTVPLEFKKC-----CYGYCIDLLEKLAEDMGFDFDLYIVGDGKYGAYKNGRW 619

  Fly   323 DGMLGDIYEQRVEMAIGCIYNWYDGITETSHTIARSSV---------TILG------PAPAPLPS 372
            .|::||:......:|          :|..|...|||.|         |.||      ...||:.:
Zfish   620 TGLVGDLMSGAAHLA----------VTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGA 674

  Fly   373 WRTNIMPFNNRAWLVLISTLVICGTFLYFMKYVSYRLRYSGTQVKFHHSRKLE-KSMLDI-FALF 435
            :   :.|.:...||.:..:|.:...||...::.|   .:..|....:..|... .|.|:: :|:.
Zfish   675 F---MWPLHWSMWLGIFVSLHVTAVFLTLYEWKS---PFGMTPRGRNRDRVFSFSSALNVCYAIL 733

  Fly   436 IQQPSAPLSFDRFAPRFF--LATILCATITLENIYSGQLKSML----TFPFYSAPVDTIEKWAQS 494
            ..:.:|......:..||.  |..|.|  :...:.|:..|.:::    |:...|...|........
Zfish   734 FGRTAAIKPPKCWTGRFLMNLWAIFC--LFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQ 796

  Fly   495 GWKWSAPSIIWVHTVQSSDLETEQILARNF-EVHDYSYLSNVSFMPNYGFGIERLSSGSLSVGDY 558
            |:::.        ||:.|  ..|..:.::| |:|:|....|....|:   ||:.|......:..:
Zfish   797 GFRFG--------TVRES--SAEDYVKKSFPEMHEYMRRYNAPTTPD---GIDHLKDDPQKLDAF 848

  Fly   559 VSTEALENRIVLHDDLYFDYTRAVSIRGWILMPELNKHIRTCQETGLYFHWELEFIDKYMDKKKQ 623
            :..:||.:.....|..|.    ::.:.|:.:..:.|..:.:             .|.:.:.:.|.
Zfish   849 IMDKALLDYWAHADKXYI----SLLLTGYGIGLKQNSPLTS-------------NISELVSQYKS 896

  Fly   624 EVLMDLANGHKVKGAP-----------QALDVRNIAGALFVLAFGVAFAGCALVAELLIHR 673
            :..||:.:....|..|           ..:.:::.:|...:|..|||.:....:.|.::||
Zfish   897 DGFMDMLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTLGEHIVHR 957

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir92aNP_001097845.2 None
grin3aXP_009303361.1 Periplasmic_Binding_Protein_Type_1 36..502 CDD:299141 0/1 (0%)
ANF_receptor 132..452 CDD:279440
PBP2_iGluR_NMDA_Nr3 518..908 CDD:270438 83/442 (19%)
Lig_chan 682..941 CDD:278489 50/293 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591704
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.