DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir92a and Ir84a

DIOPT Version :9

Sequence 1:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_649720.2 Gene:Ir84a / 40891 FlyBaseID:FBgn0037501 Length:644 Species:Drosophila melanogaster


Alignment Length:544 Identity:107/544 - (19%)
Similarity:181/544 - (33%) Gaps:182/544 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 LWT-----QKFVGAVGNLDALLLDAFLPNETFANRVELYPNKLLNLQRRSLLVGSITYVPYTITN 261
            |||     |||    ||                     :.|..: ::||:.|  ::|.:..|:..
  Fly   196 LWTHSGGYQKF----GN---------------------FKNTWV-IRRRNFL--NVTLIGSTVLT 232

  Fly   262 YVPAGQGDVDPIHPQWPNRSLTFDGAEANVMKTFCQVH---NCHLRVEAYGADNWGGIYDNESSD 323
            ..|.|.||::.:......:.|  |..:....:.|..|.   |..|.:..  .|.||.:.||.|..
  Fly   233 EKPPGFGDMEYLADDKQLQQL--DPMQRKTYQLFQLVERMFNLSLAISL--TDKWGELLDNGSWS 293

  Fly   324 GMLGDIYEQRVEMAIGCI--------YNWYDGI--TETSHTIARSSVTILGPAPAPLPSWRTNIM 378
            |::|.:..:..:.|:..|        |..|..:  |:..|.:.|.          |..|...||.
  Fly   294 GVMGQVTSREADFAVCPIRFVLDRQPYVQYSAVLHTQNIHFLFRH----------PRRSHIKNIF 348

  Fly   379 --PFNNRAW-----LVLISTLVIC---------------GTFLYFMKYVSYRLRYSGTQVKFHHS 421
              |.:|:.|     ||..||:::.               .:|::|....:|..:....::....|
  Fly   349 FEPLSNQVWWCVLALVTGSTILLLFHVRLERMLSNMENRFSFVWFTMLETYLQQGPANEIFRLFS 413

  Fly   422 RKLEKSMLDIFALFIQQPSAPLSFDRFAPRFFLATILC----ATITLENIYSGQLKSMLTFPFYS 482
            .:|..|:..||:..:.|         |...|.:.::|.    :.:.|:.:|...|...:....|:
  Fly   414 TRLLISLSCIFSFMLMQ---------FYGAFIVGSLLSESARSIVNLQALYDSNLAIGMENISYN 469

  Fly   483 APVDT-----------IEKWAQSGWKWSAPSIIWVHTVQSSDLETEQILARNFEVH--------- 527
            .|:.|           ::|..:||          .|.:.|.....|:|:...|..|         
  Fly   470 FPIFTNTSNQLVRDVYVKKICKSG----------EHNIMSLQQGAERIIQGRFAFHTAIDRMYRL 524

  Fly   528 ---------DYSYLSNVSFMPNYGFGIERLSSGSLSVGDYVSTEALENRIVLHDDLYFDYTRAVS 583
                     ::..|..|.|...|       .|||:........|.|.:.::              
  Fly   525 LLELQMDEAEFCDLQEVMFNLPY-------DSGSVMPKGSPWREHLAHALL-------------- 568

  Fly   584 IRGWILMPELNKHIRTCQETGLYFHWELEFIDKYMDKKKQEVLMDLANGHKVKGAPQALDVRNIA 648
                        |.|.   |||.         :|.|||......|.:   ..|.:...:|:.:.|
  Fly   569 ------------HFRA---TGLL---------QYNDKKWMVRRPDCS---LFKTSQAEVDLEHFA 606

  Fly   649 GALFVLAFGVAFAGCALVAELLIH 672
            .|||.||..:..:....:.||.:|
  Fly   607 PALFALALAMVASALVFLLELFLH 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir92aNP_001097845.2 None
Ir84aNP_649720.2 nt_trans <54..>112 CDD:294020
Periplasmic_Binding_Protein_Type_2 222..583 CDD:304360 82/438 (19%)
Lig_chan 355..602 CDD:278489 52/313 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.