DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir92a and GluRIA

DIOPT Version :9

Sequence 1:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_476855.1 Gene:GluRIA / 38742 FlyBaseID:FBgn0004619 Length:991 Species:Drosophila melanogaster


Alignment Length:428 Identity:88/428 - (20%)
Similarity:145/428 - (33%) Gaps:114/428 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 YGADNWGGIYDNESSDGMLGDIYEQRVEMAIGC--IYNWYDGITETSHTIARSSVTILGPAPA-P 369
            |||:|.   |.....|||:|::..:..::||..  |....:.:.:.|.......::|:...|. .
  Fly   537 YGAENQ---YAPGGWDGMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKPVKQ 598

  Fly   370 LPSWRTNIMPFNNRAWLVLISTLVICGTFLYFM-KYVSYRLR----------------------Y 411
            .|...:.:.|.:...|:.:|.:.|.....|||: ::..|..|                      .
  Fly   599 TPGVFSFLNPLSQEIWISVILSYVGVSFVLYFVTRFPPYEWRIVRRPQADSTAQQPPGIIGGATL 663

  Fly   412 SGTQVKFHHSRKLEKSMLDIF----ALFIQQPSAPLSFDRFAPRFFLATILCATITLENIYSGQL 472
            |..|.........|.:||:.|    |.|:|| ...::....|.|...|.....||.|.:.|:..|
  Fly   664 SEPQAHVPPVPPNEFTMLNSFWYSLAAFMQQ-GCDITPPSIAGRIAAAVWWFFTIILISSYTANL 727

  Fly   473 KSMLTFPFYSAPVDTIEKWAQ------------SGWKWSAPSIIWVHTVQSSDLETEQILARNFE 525
            .:.||.....||:.|.|....            |.|::...|.|.:|......:...|    :..
  Fly   728 AAFLTVERMVAPIKTPEDLTMQTDVNYGTLLYGSTWEFFRRSQIGLHNKMWEYMNANQ----HHS 788

  Fly   526 VHDYSYLSNVSFMPNYGFGIERLSSGSLSVGDY-VSTEALENRIVLHDDLYFDYTRA-------- 581
            ||.|..            ||.|:..   |.|.| :..|:.:|          :|..|        
  Fly   789 VHTYDE------------GIRRVRQ---SKGKYALLVESPKN----------EYVNARPPCDTMK 828

  Fly   582 ----VSIRGW--------ILMPELNKHIRTCQETG----LYFHWELEFIDKYMDKKKQEVLMDLA 630
                :..:|:        .|...||:.:.|.:|.|    :...|       :.||.:       .
  Fly   829 VGRNIDTKGFGVATPIGSPLRKRLNEAVLTLKENGELLRIRNKW-------WFDKTE-------C 879

  Fly   631 NGHKVKGAPQALDVRNIAGALFVLAFGVAFAGCALVAE 668
            |..:....|..|.:.|:||..::|..|:..|....:.|
  Fly   880 NLDQETSTPNELSLSNVAGIYYILIGGLLLAVIVAIME 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir92aNP_001097845.2 None
GluRIANP_476855.1 PBP1_iGluR_AMPA 41..453 CDD:107375
ANF_receptor 53..434 CDD:279440
PBP2_iGluR_AMPA 477..879 CDD:270433 78/388 (20%)
Lig_chan 612..907 CDD:278489 68/338 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462556
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.