DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir92a and Ir60e

DIOPT Version :9

Sequence 1:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_611927.3 Gene:Ir60e / 37917 FlyBaseID:FBgn0035019 Length:572 Species:Drosophila melanogaster


Alignment Length:515 Identity:103/515 - (20%)
Similarity:164/515 - (31%) Gaps:191/515 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 VGNLDALLLD-------AFLPNE----------TFANRVELYPNKLLNLQRRSLLVGSITYVPYT 258
            |.:|...|||       .||.||          |:..: |.:.|.:|...:     |..:|:||.
  Fly   102 VASLLPRLLDELHELHIVFLSNEEPGFPKQDLYTYCFK-EGFVNVILMSGK-----GLYSYLPYP 160

  Fly   259 ITNYVPAGQGDVDPIHPQWPNRSLTFDGAEANVMKTF----CQVHNCHLRVEAYGADN-WGGI-- 316
                      .:.||  ...|.|..||  .|.:::.|    .::....|....:...| .||:  
  Fly   161 ----------SIQPI--SLSNVSEYFD--RARIIRNFQGFPVRILRSTLAPRDFEYSNEQGGLVR 211

  Fly   317 --------------YDNESSDGMLGDIYEQRVEMAIG-----------CIYNWYDGITETSHTIA 356
                          |:.......:.|:.|..|.:|:.           |.:.  |...|.::|..
  Fly   212 AGYLFTAVKELTYRYNATIESVPIPDLPEYDVYLAVAEMLHTKKIDIVCYFK--DFSLEVAYTAP 274

  Fly   357 RSSVT--ILGPAPAPLPSWRTNIMPFNNRAWLVLISTLVICGT-----------------FLYFM 402
            .|.:.  .:.|...|:.|:.....||....|.|:||| |:.||                 .||.:
  Fly   275 LSIIREYFMAPHARPISSYLYYSKPFGWTLWAVVIST-VLYGTVMLHLAARGARVEIGKCLLYSL 338

  Fly   403 KYVSY----RLRYSG-TQVKFHHSRKLEKSMLDIFALFIQQPSAPLSFDRFAPRFFLATILCATI 462
            .::.|    ::|.:| ..|..|                                   ..:.....
  Fly   339 SHILYNCHQKIRVAGWRDVAIH-----------------------------------GILTIGGF 368

  Fly   463 TLENIYSGQLKSMLTFPFYSAPVDTIEKWAQSGWKWSAPSIIWVHTVQSSDLETEQILARNFEVH 527
            .|.|:|...|.|:||...|....:|:|..|::.:    ||:                       |
  Fly   369 ILTNVYLATLSSILTSGLYDEEYNTLEDLARAPY----PSL-----------------------H 406

  Fly   528 DYSYLSNV---SFMPNYGFGIERLSSGSLSVGDYVSTEALENRIVLHDD----LYFDYTRAVSIR 585
            |..|.|.:   :|:|      |||...|||:.   :|.....|..|:..    ||.|....:.::
  Fly   407 DEYYRSQMKAKTFLP------ERLRRNSLSLN---ATLLKAYRDGLNQSYIYILYEDRLELILMQ 462

  Fly   586 GWIL-MPELNKHIRT---------CQETGL-YFHWELEFIDKYMD-----KKKQEVLMDL 629
            .::| .|..|. ||.         |....| |.....||:.:..:     |.|.:...:|
  Fly   463 QYLLKTPRFNM-IRQAVGFTLESYCVSNSLPYLAMTSEFMRRLQEHGISIKMKADTFREL 521



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.