DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir92a and Ir56c

DIOPT Version :9

Sequence 1:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_611431.1 Gene:Ir56c / 37251 FlyBaseID:FBgn0034457 Length:567 Species:Drosophila melanogaster


Alignment Length:388 Identity:74/388 - (19%)
Similarity:137/388 - (35%) Gaps:96/388 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 PYRDINFELWTQKFVGAVGNLDAL--LLDAF----LPNETFANRVEL--YPNKL-LNLQRRSLLV 249
            |..|:....:.|:|..::.:.:::  :...|    .|..:|.||.:.  |..|: ..:|.....|
  Fly   112 PIYDLLTFAYNQQFFNSMVHFESMEGVNQLFGVSKFPVMSFENRTDFLKYMGKIWKQVQNARSDV 176

  Fly   250 GSITYVPYTITNYVPAGQGDVDPIHPQWPNRSLT---FDGAEANVMKTFCQVHNCHLRVEAYGAD 311
            |               |.|...|:....|:...:   :||:...:::||.:..|...:......|
  Fly   177 G---------------GFGFTTPLRQDLPHLFQSQGHYDGSTYRIIETFVRFINGSFKELIMPPD 226

  Fly   312 NWGGIYDNESSDGMLGDIYEQRVEMAIGCIYNW----YDGITETSHTIARSSVTILGPAPAPLPS 372
            :.||...|......|  |.|:::|.   |.:.:    .|...|.|:.:......::.|....:.:
  Fly   227 SLGGQVINMKDALQL--IRERKMEF---CAHAYALFMSDEELEKSYPLLVVQWCLMVPLYNSVST 286

  Fly   373 WRTNIMPFNNRAWLVLISTLVICGTFLYFMKYVSYRL--RYSGTQVKFHHSRKLEKSMLDIFALF 435
            :...:.||:...|...:..|:.    |..::.:..|:  .:||          ...::|:.|...
  Fly   287 YFYPLQPFDWNVWFFALGALLA----LVLLELMWLRMFGGWSG----------YRGAVLNSFCYI 337

  Fly   436 I--------QQPSAPLSFDRFAPRFFLATILCATITLENIYSGQLKSMLTFPFYSAPVDTIEKWA 492
            |        |||.. |.|      ..|||:......|...|:..|.|:||...:.|.::|:....
  Fly   338 INVPIEGQLQQPCL-LRF------LLLATVFFHGFFLSAYYTSNLGSILTVNLFHAQINTMNDIV 395

  Fly   493 QSGWKWSAPSIIWVHTVQSSDLETEQILARN------------------FEVHDYSYLSNVSF 537
            .:    ..|.:|       .|.|.|.:|..|                  |..|..|:.|:.::
  Fly   396 SA----QLPVMI-------IDYEMEFLLNLNKELPQEFLELLRPVDSAVFSEHQTSFNSSFAY 447



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.