DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir92a and Ir56b

DIOPT Version :9

Sequence 1:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:435 Identity:86/435 - (19%)
Similarity:151/435 - (34%) Gaps:123/435 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 FDGAEANVMKTFCQVHNCHLRVEAYGA---------DNWGGIYD----------NESSDGMLGDI 329
            |.|....::|.|.:|::..|.:::..:         |...|.|:          .|:||      
  Fly    36 FCGPYMEIVKHFAEVYHYQLFLDSLESLPKKSVVEQDIISGKYNLSLHGVIIRPEETSD------ 94

  Fly   330 YEQRVEMAIGCIYNWYDGITETSHTIARSSVTILGPAPAPLPSWRTNIMPFNNRAWLVLISTLVI 394
                           :...|:.|:.:...:..::.|....||.|...:.|.....|     |.:.
  Fly    95 ---------------FFNATQHSYPLELMTNCVMVPLAPELPKWMYMVWPLGKYIW-----TCLF 139

  Fly   395 CGTFLYFMKYVSYRLRYSGTQVKFHHSRKLEKSMLDIFALFI----QQPSAPLSFDRFAPRFFLA 455
            .|||     ||:..|||...:...:.:|...:::|...||.:    ...|..|.........|..
  Fly   140 LGTF-----YVALLLRYVHWREPGNATRSYTRNVLHAMALLMFSANMNMSVKLKHASIRVIIFYT 199

  Fly   456 TILCATITLENIYSGQLKSMLTFPFYSAPVDTIEKWAQSGWKWSAPSIIWVHTVQSSDLETEQIL 520
            .:......|.|.:...:.:....|.:..|:||                 |      |||...:: 
  Fly   200 LLYIFGFILTNYHLSHMTAFDMKPVFLRPIDT-----------------W------SDLIHSRL- 240

  Fly   521 ARNFEVHDYSYLSNVSFMPNYGFGIERLSSGSLSVGDYVSTEALENRIVLHDDLYFDYTRAVSIR 585
              ...:|| |.|..:.::|.|.   ..|:|.|.|....|:.:|.         |:|:..:.|.|:
  Fly   241 --RIVIHD-SLLEELRWLPVYQ---ALLASPSRSYAYVVTQDAW---------LFFNRQQKVLIQ 290

  Fly   586 GWILMPE---------------------LNKHIRTCQETGLYFHWELEFIDKYMDKK-KQEVLMD 628
            .:..:.:                     |||.|....:.||:.:|| |...:|.::. ..:|.:|
  Fly   291 PYFHLSKVCFGGLFNALPMASNASFADSLNKFILNVWQAGLWNYWE-ELAFRYAEQAGYAKVFLD 354

  Fly   629 LANGHKVKGAPQALDVRNIAGALFVLAFGVAFAGCALVAELLIHR 673
            .   :.|    :.|::.....|..||:.|:..:..|...||.|||
  Fly   355 T---YPV----EPLNLEFFTTAWIVLSAGIPISSLAFCLELFIHR 392



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.