DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir92a and Ir25a

DIOPT Version :9

Sequence 1:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001260049.1 Gene:Ir25a / 33683 FlyBaseID:FBgn0031634 Length:947 Species:Drosophila melanogaster


Alignment Length:444 Identity:81/444 - (18%)
Similarity:149/444 - (33%) Gaps:141/444 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 WGGI----YDNESSDGMLG--DIYEQRVEMAIGCIYNWYDGITETSHTIARSSVTILGPAPAPLP 371
            |.||    .|.::..| ||  .:..:| |:.|.....:||.:          .:||:...|:...
  Fly   500 WNGIVKKLMDKQADIG-LGSMSVMAER-EIVIDFTVPYYDLV----------GITIMMQRPSSPS 552

  Fly   372 SWRTNIMPFNNRAWLVLISTLVICGTFLYFMKYVSYR---LRYSGTQVKFHHSRKLEKSMLDIFA 433
            |....:.......||.:::...    |..|:.::..|   ..|...:.|:....:..:..|....
  Fly   553 SLFKFLTVLETNVWLCILAAYF----FTSFLMWIFDRWSPYSYQNNREKYKDDEEKREFNLKECL 613

  Fly   434 LFIQQPSAPLSFDRFAPRFFLATILCATITLENI-----YSGQLKSMLTFPFYSAPVDTIEKWAQ 493
            .|......|..... ||:.....::.||..|...     |:..|.:.||......||::::.   
  Fly   614 WFCMTSLTPQGGGE-APKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPVESLDD--- 674

  Fly   494 SGWKWSAPSIIWVHTVQSSDLETEQILARNFEVHDYSYLSNVSFMPNYGFGIERLSS-------- 550
                                      ||:.:::. |:.|:..|.|..:    ||:|:        
  Fly   675 --------------------------LAKQYKIL-YAPLNGSSAMTYF----ERMSNIEQMFYEI 708

  Fly   551 -GSLSVGDYVSTEALE-NRIVLHDDLYFD-YTRAVSIRGWILMPE------LNKHI----RTCQE 602
             ..||:.|  |..|:| :::.:.|....| ||:.     |..|.|      |::.:    .:...
  Fly   709 WKDLSLND--SLTAVERSKLAVWDYPVSDKYTKM-----WQAMQEAKLPATLDEAVARVRNSTAA 766

  Fly   603 TGLYF-------------HWELEFI--------------------DKY-------MDKKKQEVLM 627
            ||..|             :.:|:.:                    |::       ::|::.|.|.
  Fly   767 TGFAFLGDATDIRYLQLTNCDLQVVGEEFSRKPYAIAVQQGSHLKDQFNNAILTLLNKRQLEKLK 831

  Fly   628 D--------LANGHKVKGAPQALDVRNIAGALFVLAFGVAFAGCALVAELLIHR 673
            :        ||...|.:.....:.::||.|...|:..|:..|...||.|...:|
  Fly   832 EKWWKNDEALAKCDKPEDQSDGISIQNIGGVFIVIFVGIGMACITLVFEYWWYR 885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir92aNP_001097845.2 None
Ir25aNP_001260049.1 PBP1_iGluR_AMPA_Like 40..426 CDD:107378
PBP2_iGluR_putative 438..836 CDD:270435 68/393 (17%)
Lig_chan 565..870 CDD:278489 59/350 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463081
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.