DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir92a and GRIN2A

DIOPT Version :9

Sequence 1:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster
Sequence 2:XP_016878661.1 Gene:GRIN2A / 2903 HGNCID:4585 Length:1516 Species:Homo sapiens


Alignment Length:393 Identity:78/393 - (19%)
Similarity:150/393 - (38%) Gaps:79/393 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 NESSDGMLGDIYEQRVEMAIGC---------IYNWYDGITET--SHTIARSSVTILGPAPAPLPS 372
            |...:||:|::..||..||:|.         :.::.....||  |..::||:.|:   :|:..  
Human   542 NNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTV---SPSAF-- 601

  Fly   373 WRTNIMPFNNRAWLVL-ISTLVICGTFLYFMKY---VSYRLRYSGTQVKFHHSRKLEKSMLDIFA 433
                :.||:...|::: :..|::....::..:|   |.|....:..:.....|..:.|::..::.
Human   602 ----LEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWG 662

  Fly   434 LF------IQQPSAPLSFDRFAPRFFLATILCATITLENIYSGQLKS-MLTFPFYSAPVDTIEKW 491
            |.      :|.|....|....:...|.|.|..|:      |:..|.: |:...|........:|.
Human   663 LVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLAS------YTANLAAFMIQEEFVDQVTGLSDKK 721

  Fly   492 AQSGWKWSAPSIIWVHTVQSSDLETEQILARNFE-VHDYSYLSNVSFMPNYGFGIE----RLSSG 551
            .|....:|.|  ....||.:.  .||:.:..|:. :|.|....|..       |:|    .|.:|
Human   722 FQRPHDYSPP--FRFGTVPNG--STERNIRNNYPYMHQYMTKFNQK-------GVEDALVSLKTG 775

  Fly   552 SLSVGDYVSTEALENRIVLHDDLYFDYTRAVSIRGWILMPELNKHIRTCQETGLYFH----WE-- 610
            .|..             .::|....:| :|....|..|:...:.:|......|:...    |:  
Human   776 KLDA-------------FIYDAAVLNY-KAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQ 826

  Fly   611 -----LEFI-DKYMDKKKQEVLMDLANGHKVKGAPQALDVRNIAGALFVLAFGVAFAGCALVAEL 669
                 |:|: |..|::.:...|..:.:..|.:.....||:.|:||..::||..:|.:....:.|.
Human   827 IDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEH 891

  Fly   670 LIH 672
            |.:
Human   892 LFY 894



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156042
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.