DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir92a and Grik5

DIOPT Version :9

Sequence 1:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster
Sequence 2:XP_006228444.1 Gene:Grik5 / 24407 RGDID:2735 Length:980 Species:Rattus norvegicus


Alignment Length:505 Identity:102/505 - (20%)
Similarity:175/505 - (34%) Gaps:129/505 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 NETFA-NRVELYPNKLLNLQRRSLLVGSITYVPYTITNYVPAGQGDVDPIHPQWPN-RSLT---- 283
            |.|.| |...|..|....|..::|:|.:|...||.:..                || ::|:    
  Rat   394 NRTLAMNATTLDINLSQTLANKTLVVTTILENPYVMRR----------------PNFQALSGNER 442

  Fly   284 FDGAEANVMKTFCQVHNCHLRVEAYGADNWGGIYDNESSDGMLGD-IYEQRVEMAIGC--IYNWY 345
            |:|...::::...::.....|:.......:|....|.|..||:|: |..|:.::|:..  |....
  Rat   443 FEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGSWTGMVGELINRQKADLAVAAFTITAER 507

  Fly   346 DGITETSHTIARSSVTIL-----GPAPAPLPSWRTNIMPFNNRAWL-VLISTLVI-CGTFL---- 399
            :.:.:.|.......::||     |..    |.:.:.:.||:...|| :|::.|.: |..||    
  Rat   508 EKVIDFSKPFMTLGISILYRVHMGRK----PGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARL 568

  Fly   400 ----YFMKYVSYRLRYSGTQVKFHHSRKLEKSMLDIFALFIQQPSAPLSFDRFAPRFFLATILCA 460
                ::..:...|.|....:.::    .|..|:......|:||.|      ...||......:..
  Rat   569 SPYEWYNPHPCLRARPHILENQY----TLGNSLWFPVGGFMQQGS------EIMPRALSTRCVSG 623

  Fly   461 -----TITLENIYSGQLKSMLTFPFYSAPVDTIEKWA---------------------------Q 493
                 |:.:.:.|:..|.:.||......||::.:..|                           |
  Rat   624 VWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQ 688

  Fly   494 SGWKW---SAPSIIWVHTVQSSDLETEQILARNFEVHDYSYLSNVSFMPNYGFGIERLSSGSLSV 555
            ..|.:   ..||:.    |:|    ||:.:||..... |::|.. |.|..|.   .||:.....:
  Rat   689 RMWNYMQSKQPSVF----VKS----TEEGIARVLNSR-YAFLLE-STMNEYH---RRLNCNLTQI 740

  Fly   556 GDYVSTEALENRIVLHDDLYFDYTRAVSIRGWILMPELNKHIRTCQETGLYFHWELEFIDKYMDK 620
            |..:.|:.....:.|......:.|.|      ||..:.|..:...:..    .||.....|..| 
  Rat   741 GGLLDTKGYGIGMPLGSPFRDEITLA------ILQLQENNRLEILKRK----WWEGGRCPKEED- 794

  Fly   621 KKQEVLMDLANGHKVKGAPQALDVRNIAGALFVLAFGVAFAGCALVAELL 670
                        |:.||    |.:.||.|...||..|:..|....|.|.:
  Rat   795 ------------HRAKG----LGMENIGGIFVVLICGLIIAVFVAVMEFI 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir92aNP_001097845.2 None
Grik5XP_006228444.1 PBP1_iGluR_Kainate_KA1_2 23..401 CDD:380616 3/6 (50%)
Periplasmic_Binding_Protein_Type_2 414..785 CDD:389745 78/423 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350158
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.