DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir92a and gria3a

DIOPT Version :9

Sequence 1:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster
Sequence 2:XP_005165152.1 Gene:gria3a / 170452 ZFINID:ZDB-GENE-020125-5 Length:903 Species:Danio rerio


Alignment Length:551 Identity:90/551 - (16%)
Similarity:182/551 - (33%) Gaps:163/551 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 GGAGNKTTSPY------RDINFELWTQKFVGAVGNLDALLLDAFLPNETFANRVELY-------- 235
            |.||:...:|.      .||...|...:..|..||:.   .|:|.....:.  |::|        
Zfish   328 GSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNIQ---FDSFGRRSNYT--VDVYEMKPGGAR 387

  Fly   236 -------------------PNKLLNLQRRSLLVGSITYVPYTI--TNYVPAGQGDVDPIHPQWPN 279
                               .|:..:::.|:::|.:|...||.:  .||:.....|          
Zfish   388 KIGYWNEFEKFVYIVEQQVTNESSSVENRTIVVTTIMEAPYVMYKRNYMQLEGND---------- 442

  Fly   280 RSLTFDGAEANVMKTFCQVHNCHLRVE---AYGADNWGGIYDNESS--DGMLGDIYEQRVEMAIG 339
               .::|...::.....:    |:.::   :..||...|..|.|:.  :||:|::...|.::|:.
Zfish   443 ---RYEGYCVDLASEIAK----HVGIKYKLSIVADGKYGARDPETKTWNGMVGELVYGRADIAVA 500

  Fly   340 CIYNWYDGITETSHTIARSSVTILGPAPAPLPSWRTNIM----------------PFNNRAWLVL 388
            .:          :.|:.|..|....   .|..|...:||                |.....|:.:
Zfish   501 PL----------TITLVREEVIDFS---KPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCI 552

  Fly   389 ISTLVICGTFLYFMKYVSYRLRYSGTQVKFHHSRKLEKSMLDIFALFIQQPSAPLSFDRF----- 448
            :...:.....|:.:.      |:|..:.....:.:.:...        ..|..|..|..|     
Zfish   553 VFAYIGVSVVLFLVS------RFSPYEWHLDDNEETKDPQ--------TPPDPPNDFGIFNSLWF 603

  Fly   449 ------------APRFFLATILCA-----TITLENIYSGQLKSMLTFPFYSAPVDTIEKWAQSGW 496
                        :||.....|:..     |:.:.:.|:..|.:.||.....:|:::.|..|:.  
Zfish   604 SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQ-- 666

  Fly   497 KWSAPSIIWVHTVQSSDLETEQILARN-FEVHD--YSYLSNVS---FMPNYGFGIERL--SSGSL 553
                 :.|...|:.|.  .|::...|: ..|::  :||:.:..   |:.....|:.|:  |.|..
Zfish   667 -----TEIAYGTLDSG--STKEFFRRSKIAVYEKMWSYMKSAEPSVFVKTTPDGVARVRKSKGKF 724

  Fly   554 ------SVGDYVSTEALENRIVLHDDLYFDYTRAVSIRGWILMPELNKHIRTCQETGLYFHWELE 612
                  ::.:|:......:.:.:..:|........:.:|..|...:|..:....|.|:       
Zfish   725 AFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGI------- 782

  Fly   613 FIDKYMDKKKQEVLMDLAN-GHKVKGAPQAL 642
                 :||.|.:...|... |.|..|:..:|
Zfish   783 -----LDKLKNKWWYDKGECGTKDSGSKVSL 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir92aNP_001097845.2 None
gria3aXP_005165152.1 PBP1_iGluR_AMPA_GluR3 28..399 CDD:107382 14/75 (19%)
ANF_receptor 39..382 CDD:279440 14/58 (24%)
PBP2_iGluR_AMPA 415..797 CDD:270433 71/446 (16%)
Lig_chan 547..810 CDD:278489 47/297 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591776
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.