DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir92a and Grin2a

DIOPT Version :9

Sequence 1:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_032196.2 Gene:Grin2a / 14811 MGIID:95820 Length:1464 Species:Mus musculus


Alignment Length:393 Identity:78/393 - (19%)
Similarity:150/393 - (38%) Gaps:79/393 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 NESSDGMLGDIYEQRVEMAIGC---------IYNWYDGITET--SHTIARSSVTILGPAPAPLPS 372
            |...:||:|::..||..||:|.         :.::.....||  |..::||:.|:   :|:..  
Mouse   490 NNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTV---SPSAF-- 549

  Fly   373 WRTNIMPFNNRAWLVL-ISTLVICGTFLYFMKY---VSYRLRYSGTQVKFHHSRKLEKSMLDIFA 433
                :.||:...|::: :..|::....::..:|   |.|....:..:.....|..:.|::..::.
Mouse   550 ----LEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWG 610

  Fly   434 LF------IQQPSAPLSFDRFAPRFFLATILCATITLENIYSGQLKS-MLTFPFYSAPVDTIEKW 491
            |.      :|.|....|....:...|.|.|..|:      |:..|.: |:...|........:|.
Mouse   611 LVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLAS------YTANLAAFMIQEEFVDQVTGLSDKK 669

  Fly   492 AQSGWKWSAPSIIWVHTVQSSDLETEQILARNFE-VHDYSYLSNVSFMPNYGFGIE----RLSSG 551
            .|....:|.|  ....||.:.  .||:.:..|:. :|.|....|..       |:|    .|.:|
Mouse   670 FQRPHDYSPP--FRFGTVPNG--STERNIRNNYPYMHQYMTKFNQR-------GVEDALVSLKTG 723

  Fly   552 SLSVGDYVSTEALENRIVLHDDLYFDYTRAVSIRGWILMPELNKHIRTCQETGLYFH----WE-- 610
            .|..             .::|....:| :|....|..|:...:.:|......|:...    |:  
Mouse   724 KLDA-------------FIYDAAVLNY-KAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQ 774

  Fly   611 -----LEFI-DKYMDKKKQEVLMDLANGHKVKGAPQALDVRNIAGALFVLAFGVAFAGCALVAEL 669
                 |:|: |..|::.:...|..:.:..|.:.....||:.|:||..::||..:|.:....:.|.
Mouse   775 IDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEH 839

  Fly   670 LIH 672
            |.:
Mouse   840 LFY 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir92aNP_001097845.2 None
Grin2aNP_032196.2 PBP1_iGluR_NMDA_NR2 32..392 CDD:107373
PBP2_iGluR_NMDA_Nr2 403..802 CDD:270436 67/351 (19%)
HisJ <458..>541 CDD:223904 13/50 (26%)
Lig_chan 556..828 CDD:278489 57/302 (19%)
NMDAR2_C 839..1464 CDD:287527 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.