DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt2 and sirt1

DIOPT Version :9

Sequence 1:NP_001287422.2 Gene:Sirt2 / 42414 FlyBaseID:FBgn0038788 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_001334440.4 Gene:sirt1 / 797132 ZFINID:ZDB-GENE-070801-2 Length:710 Species:Danio rerio


Alignment Length:319 Identity:128/319 - (40%)
Similarity:181/319 - (56%) Gaps:53/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RKIVTMVGAGISTSAGIPDFRSPGSGLYSNLKK--YELPHPTAIFDLDYFEKNPAPFFALAKELY 141
            :||:.:.|||:|.|.||||||| ..|:|:.|..  .:||.|.|:||:|||.::|.|||..|||:|
Zfish   190 KKILVLTGAGVSVSCGIPDFRS-RDGIYARLAVDFPDLPDPQAMFDIDYFRRDPRPFFKFAKEIY 253

  Fly   142 PGSFIPTPAHYFIRLLNDKGLLQRHYTQNIDTLDRLTGLPEDKIIEAHGSFHTNHCIKCRKEYDM 206
            ||.|.|:|.|.||.:|:.||.|.|:||||||||:::.|:  .|||:.||||.|..|:.|:.:.|.
Zfish   254 PGQFQPSPCHRFISMLDKKGRLLRNYTQNIDTLEQVAGI--QKIIQCHGSFATASCLICKHKVDC 316

  Fly   207 DWMKAEIFADRLPKCQKC-----QGVVKPDIVFFGENLPKRFYSSPEEDFQDCDLLIIMGTSLEV 266
            :.::.:||...:|.|.:|     ..::||||||||||||:.|:.:.::|..:.||||::|:||:|
Zfish   317 EAIREDIFNQVVPHCPRCPSDVPYAIMKPDIVFFGENLPEFFHRAMKQDKDEVDLLIVIGSSLKV 381

  Fly   267 QPFASLVWRPGPRCI-----RLLINRDAVGQASCVLFMDPNTRSLLFDKPNNTRDVAFLGDCDAG 326
            :|.|.:     |..|     ::||||:.:                    |:...||..|||||..
Zfish   382 RPVALI-----PSSIPHDVPQVLINREPL--------------------PHLNFDVELLGDCDVI 421

  Fly   327 VMALAKALGWDQELQQLITSERKKLSGSQNSEELQQGKEKPQS-DPDKMTSGDRDKKDA 384
            |..|...|..|  .|||          ..||..|.:..|||.: :..:.||.|....||
Zfish   422 VNELCHRLNGD--FQQL----------CYNSSRLSEITEKPAAPEHTENTSADHSHADA 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt2NP_001287422.2 SIRT1 79..330 CDD:238699 111/262 (42%)
sirt1XP_001334440.4 SIRT1 190..425 CDD:238699 111/262 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D512963at33208
OrthoFinder 1 1.000 - - FOG0000643
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R577
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.