DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt2 and sirt4

DIOPT Version :9

Sequence 1:NP_001287422.2 Gene:Sirt2 / 42414 FlyBaseID:FBgn0038788 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001005988.1 Gene:sirt4 / 791628 ZFINID:ZDB-GENE-041010-65 Length:310 Species:Danio rerio


Alignment Length:264 Identity:67/264 - (25%)
Similarity:113/264 - (42%) Gaps:57/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ANTLHLG--------GSSDAKEEVKVEKVIPDLSFDGFAEHWRVHGFRKIVTMVGAGISTSAGIP 96
            |:|:..|        ||.|:....:::..|...|              ::..:.|||:||.:|||
Zfish    18 ASTIQAGVRQFVPASGSFDSSALEQLQAFISQAS--------------RLFVISGAGLSTESGIP 68

  Fly    97 DFRSPGSGLYSNLKKYELPHPTAIFDLDYFEKNPAPFFALAKELYP--GSFIPTPAHYFIRLLND 159
            |:||.|.|||:...:..:.|...:..    ||:...::|.....:|  .|..|..||..:|...:
Zfish    69 DYRSEGVGLYARTNRRPMQHSEFVRS----EKSRQRYWARNYVGWPQFSSHQPNSAHLALRDWEE 129

  Fly   160 KGLLQRHYTQNIDTLDRLTGLPEDKIIEAHGSFHTNHCIKC---------RKEY----------- 204
            ||.|....|||:|.|....|  :.::.|.|||.|...|:.|         :|.:           
Zfish   130 KGKLHWLVTQNVDALHLKAG--QQRLTELHGSTHRVVCLDCGELTPRAELQKRFTALNPGWEATA 192

  Fly   205 -------DMDWMKAEIFADRLPKCQKCQGVVKPDIVFFGENLPKRFYSSPEEDFQDCDLLIIMGT 262
                   |:...:.::...|:|.|..|.||:||::.|||:.:.:...........:.|.:::.|:
Zfish   193 CAVAPDGDVFLEEEQVLNFRVPACNACGGVLKPEVTFFGDVVNRNTVHFVHNKLAESDAVLVAGS 257

  Fly   263 SLEV 266
            ||:|
Zfish   258 SLQV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt2NP_001287422.2 SIRT1 79..330 CDD:238699 59/217 (27%)
sirt4NP_001005988.1 SIRT4 43..304 CDD:238700 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.