DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt2 and Sirt3

DIOPT Version :9

Sequence 1:NP_001287422.2 Gene:Sirt2 / 42414 FlyBaseID:FBgn0038788 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001171275.1 Gene:Sirt3 / 64384 MGIID:1927665 Length:334 Species:Mus musculus


Alignment Length:311 Identity:159/311 - (51%)
Similarity:194/311 - (62%) Gaps:33/311 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GGSSDAKEEVKVEKVIPDLSFDGFAEHWRVHGFRKIVTMVGAGISTSAGIPDFRSPGSGLYSNLK 110
            ||||:.|           .|....||..|.....::|.||||||||.:||||||||||||||||:
Mouse    51 GGSSEKK-----------FSLQDVAELLRTRACSRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQ 104

  Fly   111 KYELPHPTAIFDLDYFEKNPAPFFALAKELYPGSFIPTPAHYFIRLLNDKGLLQRHYTQNIDTLD 175
            :|::|:|.|||:|.:|..||.|||.||||||||.:.|...|||:|||:||.||.|.||||||.|:
Mouse   105 QYDIPYPEAIFELGFFFHNPKPFFMLAKELYPGHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLE 169

  Fly   176 RLTGLPEDKIIEAHGSFHTNHCIKCRKEYDMDWMKAEIFADRLPKCQKCQGVVKPDIVFFGENLP 240
            |.:|:|..|::||||:|.|..|..||:.:..:.:.|::.|||:|:|..|.||||||||||||.||
Mouse   170 RASGIPASKLVEAHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCPVCTGVVKPDIVFFGEQLP 234

  Fly   241 KRFYSSPEEDFQDCDLLIIMGTSLEVQPFASL---VWRPGPRCIRLLINRDAVGQASCVLFMDPN 302
            .||... ..||...|||:|:||||||:|||||   |.:..|   |||||||.||.    ..:.| 
Mouse   235 ARFLLH-MADFALADLLLILGTSLEVEPFASLSEAVQKSVP---RLLINRDLVGP----FVLSP- 290

  Fly   303 TRSLLFDKPNNTRDVAFLGDCDAGVMALAKALGWDQELQQLITSERKKLSG 353
                      ..:||..|||...||..|...|||.|||..|:..||.||.|
Mouse   291 ----------RRKDVVQLGDVVHGVERLVDLLGWTQELLDLMQRERGKLDG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt2NP_001287422.2 SIRT1 79..330 CDD:238699 137/253 (54%)
Sirt3NP_001171275.1 SIRT1 74..308 CDD:238699 137/252 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54280
OrthoDB 1 1.010 - - D512963at33208
OrthoFinder 1 1.000 - - FOG0000643
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101879
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R577
SonicParanoid 1 1.000 - - X1602
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.