DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt2 and sirt3

DIOPT Version :9

Sequence 1:NP_001287422.2 Gene:Sirt2 / 42414 FlyBaseID:FBgn0038788 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_009301762.1 Gene:sirt3 / 558775 ZFINID:ZDB-GENE-070112-1762 Length:358 Species:Danio rerio


Alignment Length:306 Identity:151/306 - (49%)
Similarity:193/306 - (63%) Gaps:24/306 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GGSSDAKEEVKVEKVIPDLSFDGFAEHWRVHGFRKIVTMVGAGISTSAGIPDFRSPGSGLYSNLK 110
            ||..|...:..:|.:         ||..|...|::||.|.||||||.:|||||||||||||.||:
Zfish    77 GGGRDNVHQQTLEDI---------AEKIRERKFKRIVVMAGAGISTPSGIPDFRSPGSGLYDNLQ 132

  Fly   111 KYELPHPTAIFDLDYFEKNPAPFFALAKELYPGSFIPTPAHYFIRLLNDKGLLQRHYTQNIDTLD 175
            :|.||:..|||:::||..||.||||||||||||::.|...|||||:|:||..|.|.||||||.|:
Zfish   133 QYNLPYAEAIFEINYFHHNPNPFFALAKELYPGNYQPNLTHYFIRMLHDKEQLLRMYTQNIDGLE 197

  Fly   176 RLTGLPEDKIIEAHGSFHTNHCIKCRKEYDMDWMKAEIFADRLPKCQKCQGVVKPDIVFFGENLP 240
            |:.|:|...::||||:|.|..|..||::|..:.::.:|.|..:|||..|:|::|||||||||.||
Zfish   198 RMAGIPPKMLVEAHGTFATATCTVCRRDYKGEELRDDIMAGTVPKCPTCKGIIKPDIVFFGEELP 262

  Fly   241 KRFYSSPEEDFQDCDLLIIMGTSLEVQPFASLVWRPGPRCIRLLINRDAVGQASCVLFMDPNTRS 305
            :.|::. ..||...||||:|||||||:|||||.........|||||||.||.     |...:.|.
Zfish   263 QHFFTY-LTDFPIADLLIVMGTSLEVEPFASLAGAVRGSVPRLLINRDLVGP-----FASGSQRH 321

  Fly   306 LLFDKPNNTRDVAFLGDCDAGVMALAKALGWDQELQQLITSERKKL 351
                     .|||.|||...||..|.:.|||.|||:.|:...|.|:
Zfish   322 ---------TDVAELGDVVNGVKKLVELLGWKQELEDLMNVGRDKV 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt2NP_001287422.2 SIRT1 79..330 CDD:238699 133/250 (53%)
sirt3XP_009301762.1 SIRT1 101..337 CDD:238699 133/250 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54280
OrthoDB 1 1.010 - - D512963at33208
OrthoFinder 1 1.000 - - FOG0000643
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101879
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R577
SonicParanoid 1 1.000 - - X1602
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.