DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt2 and Sirt5

DIOPT Version :9

Sequence 1:NP_001287422.2 Gene:Sirt2 / 42414 FlyBaseID:FBgn0038788 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001004256.1 Gene:Sirt5 / 306840 RGDID:1303285 Length:310 Species:Rattus norvegicus


Alignment Length:269 Identity:71/269 - (26%)
Similarity:104/269 - (38%) Gaps:72/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PDDTMDKVRRFFANTLHLGGSSDAKEEVKVEKVIPDLSFDGFAEHWRVHGFRKIVTMVGAGISTS 92
            |...|...|:.|||..|                                    ||.:.|||:|..
  Rat    36 PSSNMADFRKCFANAKH------------------------------------IVIISGAGVSAE 64

  Fly    93 AGIPDFRSPGSGLYSNLKKYELPHPTAIFDLDYFEKNPA---PFFALAKELYPGSFIPTPAHYFI 154
            :|:|.||..| |.:...:...|..|.|      |..||:   .|:...:|:.... .|.|.|..|
  Rat    65 SGVPTFRGTG-GYWRKWQAQHLATPLA------FAHNPSQVWEFYHYRREVMRNK-EPNPGHLAI 121

  Fly   155 ----RLLNDKGLLQRHYTQNIDTLDRLTGLPEDKIIEAHGSFHTNHCIKC---RKEY-------- 204
                ..|.|:|......|||||.|.|..|  ...::|.||:.....|..|   .:.|        
  Rat   122 AQCEARLRDQGRRVVVITQNIDELHRKAG--TKNLLEIHGTLFKTRCTSCGNVAENYKSPICPAL 184

  Fly   205 ------DMDWMKAEIFADRLPKCQK--CQGVVKPDIVFFGENLPKRFYSSPEEDFQDCDLLIIMG 261
                  :.|..::.|...:||:|::  |.|:::|.:|:|||||........:.:...|||.:::|
  Rat   185 LGKGAPEPDTQESRIPVHKLPRCEEAGCGGLLRPHVVWFGENLDPAILKEVDRELARCDLCLVVG 249

  Fly   262 TSLEVQPFA 270
            ||..|.|.|
  Rat   250 TSSVVYPAA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt2NP_001287422.2 SIRT1 79..330 CDD:238699 64/218 (29%)
Sirt5NP_001004256.1 SIRT5_Af1_CobB 51..301 CDD:238703 65/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54280
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.